Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.17
PubTator Score 0.25

Knowledge Summary

Patent (143)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.051 1.5

AA Sequence

MASTSNVTELIFTGLFQDPAVQSVCFVVFLPVYLATVVGNGLIVLTVSISKSLDSPMYFFLSCLSLVEIS      1 - 70
YSSTIAPKFIIDLLAKIKTISLEGCLTQIFFFHFFGVAEILLIVVMAYDCYVAICKPLHYMNIISRQLCH     71 - 140
LLVAGSWLGGFCHSIIQILVIIQLPFCGPNVIDHYFCDLQPLFKLACTDTFMEGVIVLANSGLFSVFSFL    141 - 210
ILVSSYIVILVNLRNHSAEGRHKALSTCASHITVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPML    211 - 280
NPIIYTLRNAEVKIAIRRLWSKKENPGRE                                             281 - 309
//

Text Mined References (2)

PMID Year Title