Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.07
PubTator Score 0.07

Knowledge Summary

Patent (95)


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

AA Sequence

VTPMLNPLIYSLRNKEVKEATRKALSKSKPARRP                                        281 - 314

Text Mined References (1)

PMID Year Title