Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.07
PubTator Score 0.07

Knowledge Summary

Patent (95)

AA Sequence

MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMYFFLSHLSLVD      1 - 70
ICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAYDRYTAVCQPLLYVTIITEKA     71 - 140
RWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCDLPPLLKLSCGDSYTQEVVIIVFALFVMPAC    141 - 210
ILVILVSYLFIIVAILQIHSAGGRAKTFSTCASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTV    211 - 280
VTPMLNPLIYSLRNKEVKEATRKALSKSKPARRP                                        281 - 314
//

Text Mined References (1)

PMID Year Title
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.