Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (113)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MDQRNYTRVKEFTFLGITQSRELSQVLFTFLFLVYMTTLMGNFLIMVTVTCESHLHTPMYFLLRNLSILD      1 - 70
ICFSSITAPKVLIDLLSETKTISFSGCVTQMFFFHLLGGADVFSLSVMAFDRYIAISKPLHYMTIMSRGR     71 - 140
CTGLIVASWVGGFVHSIAQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTDTFTLELLMISNNGLVSWFV    141 - 210
FFFLLISYTVILMMLRSHTGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDTAISVTFTVISP    211 - 280
LLNPIIYTLRNQEMKLAMRKLKRRLGQSERILIQ                                        281 - 314
//

Text Mined References (2)

PMID Year Title