Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 2.20

Knowledge Summary

Patent (196)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MICENHTRVTEFILLGFTNNPEMQVSLFIFFLAIYTVTLLGNFLIVTVTSVDLALQTPMYFFLQNLSLLE      1 - 70
VCFTLVMVPKMLVDLVSPRKIISFVGCGTQMYFFFFFGSSECFLLSMMAYDRFVAICNPLHYSVIMNRSL     71 - 140
CLWMAIGSWMSGVPVSMLQTAWMMALPFCGPNAVDHFFCDGPPVLKLVTVDTTMYEMQALASTLLFIMFP    141 - 210
FCLILVSYTRIIITILRMSSATGRQKAFSTCSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTV    211 - 280
ITPMLNPIIYGLRNNEVKGAVKRTITQKVLQKLDVF                                      281 - 316
//

Text Mined References (3)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.