Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 2.20

Knowledge Summary

Patent (196)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

AA Sequence

MICENHTRVTEFILLGFTNNPEMQVSLFIFFLAIYTVTLLGNFLIVTVTSVDLALQTPMYFFLQNLSLLE      1 - 70
VCFTLVMVPKMLVDLVSPRKIISFVGCGTQMYFFFFFGSSECFLLSMMAYDRFVAICNPLHYSVIMNRSL     71 - 140
CLWMAIGSWMSGVPVSMLQTAWMMALPFCGPNAVDHFFCDGPPVLKLVTVDTTMYEMQALASTLLFIMFP    141 - 210
FCLILVSYTRIIITILRMSSATGRQKAFSTCSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTV    211 - 280
ITPMLNPIIYGLRNNEVKGAVKRTITQKVLQKLDVF                                      281 - 316
//

Text Mined References (3)

PMID Year Title