Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 32.42

Knowledge Summary

Patent (191)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MAGENHTTLPEFLLLGFSDLKALQGPLFWVVLLVYLVTLLGNSLIILLTQVSPALHSPMYFFLRQLSVVE      1 - 70
LFYTTDIVPRTLANLGSPHPQAISFQGCAAQMYVFIVLGISECCLLTAMAYDRYVAICQPLRYSTLLSPR     71 - 140
ACMAMVGTSWLTGIITATTHASLIFSLPFRSHPIIPHFLCDILPVLRLASAGKHRSEISVMTATIVFIMI    141 - 210
PFSLIVTSYIRILGAILAMASTQSRRKVFSTCSSHLLVVSLFFGTASITYIRPQAGSSVTTDRVLSLFYT    211 - 280
VITPMLNPIIYTLRNKDVRRALRHLVKRQRPSP                                         281 - 313
//

Text Mined References (6)

PMID Year Title