Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (188)

TINX Plot

  Disease (2)

Disease Target Count P-value
non diabetic and post-ischemic heart failure 200 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

AA Sequence

MDVGNKSTMSEFVLLGLSNSWELQMFFFMVFSLLYVATMVGNSLIVITVIVDPHLHSPMYFLLTNLSIID      1 - 70
MSLASFATPKMITDYLTGHKTISFDGCLTQIFFLHLFTGTEIILLMAMSFDRYIAICKPLHYASVISPQV     71 - 140
CVALVVASWIMGVMHSMSQVIFALTLPFCGPYEVDSFFCDLPVVFQLACVDTYVLGLFMISTSGIIALSC    141 - 210
FIVLFNSYVIVLVTVKHHSSRGSSKALSTCTAHFIVVFLFFGPCIFIYMWPLSSFLTDKILSVFYTIFTP    211 - 280
TLNPIIYTLRNQEVKIAMRKLKNRFLNFNKAMPS                                        281 - 314
//

Text Mined References (3)

PMID Year Title