Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
17973576 possible functional role of OR11H7P in isovaleric acid detection

AA Sequence

MNNSQISTVTQFVLLGFPGPWKIQIIFFSMILLVYIFTLTGNMAIICAVRWDHRLHTPMYVLLANFSFLE      1 - 70
IWYVTCTVPNMLVNFFSKTKTISFSGCFTQFHFFFSLGTTECFFLCVMAYDRYLAICHPLHYPSIMTGQL     71 - 140
CGILVSLCWLIGFLGHSISIFFIFQLPFCGPNIIDHFLCDVDPLMALSSAPTHIIGHVFHSVSSLFINLT    141 - 210
MVYILGSYTLVLRTVLQVPSSAGWQKAISTCGSHLVVVSLFYGAIMLMYVSPTPGNSVAMHKLITLIYSV    211 - 280
VTPVLNPLIYSLRNKDMKYALHHVFCGMRIIQRS                                        281 - 314
//

Text Mined References (6)

PMID Year Title
17973576 2007 Genetic elucidation of human hyperosmia to isovaleric acid.
14983052 2004 The human olfactory receptor gene family.
12908129 2003 Natural selection on the olfactory receptor gene family in humans and chimpanzees.
12730696 2003 Different noses for different people.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.