Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (128)

Synonym

Accession Q8NGC7 Q6IF08
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Anole lizard OMA EggNOG

AA Sequence

MFFIIHSLVTSVFLTALGPQNRTMHFVTEFVLLGFHGQREMQSCFFSFILVLYLLTLLGNGAIVCAVKLD      1 - 70
RRLHTPMYILLGNFAFLEIWYISSTVPNMLVNILSEIKTISFSGCFLQFYFFFSLGTTECFFLSVMAYDR     71 - 140
YLAICRPLHYPSIMTGKFCIILVCVCWVGGFLCYPVPIVLISQLPFCGPNIIDHLVCDPGPLFALACISA    141 - 210
PSTELICYTFNSMIIFGPFLSILGSYTLVIRAVLCIPSGAGRTKAFSTCGSHLMVVSLFYGTLMVMYVSP    211 - 280
TSGNPAGMQKIITLVYTAMTPFLNPLIYSLRNKDMKDALKRVLGLTVSQN                        281 - 330
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.