Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (132)

AA Sequence

MEAMKLLNQSQVSEFILLGLTSSQDVEFLLFALFSVIYVVTVLGNLLIIVTVFNTPNLNTPMYFLLGNLS      1 - 70
FVDMTLASFATPKVILNLLKKQKVISFAGCFTQIFLLHLLGGVEMVLLVSMAFDRYVAICKPLHYMTIMN     71 - 140
KKVCVLLVVTSWLLGLLHSGFQIPFAVNLPFCGPNVVDSIFCDLPLVTKLACIDIYFVQVVIVANSGIIS    141 - 210
LSCFIILLISYSLILITIKNHSPTGQSKARSTLTAHITVVILFFGPCIFIYIWPFGNHSVDKFLAVFYTI    211 - 280
ITPILNPIIYTLRNKEMKISMKKLWRAFVNSREDT                                       281 - 315
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12508121 2003 The DNA sequence and analysis of human chromosome 14.