Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (161)


  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

TPFLNPLIYTLRNQEVKLALKRMLRSPRTPSEV                                         281 - 313

Text Mined References (4)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9110172 1997 Analysis of the 1.1-Mb human alpha/delta T-cell receptor locus with bacterial artificial chromosome clones.
8188290 1994 The human T-cell receptor TCRAC/TCRDC (C alpha/C delta) region: organization, sequence, and evolution of 97.6 kb of DNA.