Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (85)

Gene RIF (1)

AA Sequence

MGKTKNTSLDAVVTDFILLGLSHPPNLRSLLFLVFFIIYILTQLGNLLILLTMWADPKLCARPMYILLGV      1 - 70
LSFLDMWLSSVTVPRLILDFTPSIKAIPFGGCVAQLYFFHFLGSTQCFLYTLMAYDRYLAICQPLHYPVL     71 - 140
MNGRLCTVLVAGAWVAGSMHGSIQATLTFRLPYCGPNQVDYFICDIRAVLRLACADTTVNELVTFVDVRV    141 - 210
VAASCFMLILLSYANIVHAILKIRTADGRRRAFSTCGSHLIVVTVYYVPCIFIYLRAGSKDPLDGAAAVF    211 - 280
YTVVTPLLNPLIYTLRNQEVKSALKRITAG                                            281 - 310
//

Text Mined References (6)

PMID Year Title