Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (85)

Gene RIF (1)

PMID Text
23695671 Expression of miR-135b, LZTS1, LATS2 and nuclear TAZ predicts poor outcomes of non-small-cell lung cancer.

AA Sequence

MGKTKNTSLDAVVTDFILLGLSHPPNLRSLLFLVFFIIYILTQLGNLLILLTMWADPKLCARPMYILLGV      1 - 70
LSFLDMWLSSVTVPRLILDFTPSIKAIPFGGCVAQLYFFHFLGSTQCFLYTLMAYDRYLAICQPLHYPVL     71 - 140
MNGRLCTVLVAGAWVAGSMHGSIQATLTFRLPYCGPNQVDYFICDIRAVLRLACADTTVNELVTFVDVRV    141 - 210
VAASCFMLILLSYANIVHAILKIRTADGRRRAFSTCGSHLIVVTVYYVPCIFIYLRAGSKDPLDGAAAVF    211 - 280
YTVVTPLLNPLIYTLRNQEVKSALKRITAG                                            281 - 310
//

Text Mined References (6)

PMID Year Title
23695671 2013 MicroRNA-135b promotes lung cancer metastasis by regulating multiple targets in the Hippo pathway and LZTS1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110172 1997 Analysis of the 1.1-Mb human alpha/delta T-cell receptor locus with bacterial artificial chromosome clones.
8188290 1994 The human T-cell receptor TCRAC/TCRDC (C alpha/C delta) region: organization, sequence, and evolution of 97.6 kb of DNA.