Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (178)

Synonym

Accession Q8NGC1 Q6IF09 Q96R33
Symbols OR14-34

Gene

PANTHER Protein Class (2)

AA Sequence

MHFLSQNDLNINLIPHLCLHRHSVIAGAFTIHRHMKIFNSPSNSSTFTGFILLGFPCPREGQILLFVLFT      1 - 70
VVYLLTLMGNGSIICAVHWDQRLHAPMYILLANFSFLEICYVTSTVPSMLANFLSDTKIISFSGCFLQFY     71 - 140
FFFSLGSTECFFLAVMAFDRYLAICRPLRYPTIMTRRLCTNLVVNCWVLGFIWFLIPIVNISQMSFCGSR    141 - 210
IIDHFLCDPAPLLTLTCKKGPVIELVFSVLSPLPVFMLFLFIVGSYALVVRAVLRVPSAAGRRKAFSTCG    211 - 280
SHLAVVSLFYGSVLVMYGSPPSKNEAGKQKTVTLFYSVVTPLLNPVIYSLRNKDMRKALKKFWGT         281 - 345
//

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.