Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent (283)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Mucoepidermoid carcinoma 26 3.385 1.7

AA Sequence

MNGMNHSVVSEFVFMGLTNSREIQLLLFVFSLLFYFASMMGNLVIVFTVTMDAHLHSPMYFLLANLSIID      1 - 70
MAFCSITAPKMICDIFKKHKAISFRGCITQIFFSHALGGTEMVLLIAMAFDRYMAICKPLHYLTIMSPRM     71 - 140
CLYFLATSSIIGLIHSLVQLVFVVDLPFCGPNIFDSFYCDLPRLLRLACTNTQELEFMVTVNSGLISVGS    141 - 210
FVLLVISYIFILFTVWKHSSGGLAKALSTLSAHVTVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITP    211 - 280
FLNPVIYTFRNKDMKVAMRRLCSRLAHFTKIL                                          281 - 312
//

Text Mined References (5)

PMID Year Title