Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.06

Knowledge Summary

Patent (144)

Synonym

Accession Q8NGA6 Q6IFJ0 Q96R60
Symbols OR19-25
OR19-26

Gene

PANTHER Protein Class (2)

AA Sequence

MQGLNHTSVSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHMPMYLFLCALSITE      1 - 70
ILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGYDRYVAICHPLRYNVLMSLRG     71 - 140
CTCRVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFFCHVPPLLKLACGDDVLVVAKGVGLVCITALLG    141 - 210
CFLLILLSYAFIVAAILKIPSAEGRNKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSPEGDTLMGITYT    211 - 280
VLTPFLSPIIFSLRNKELKVAMKKTCFTKLFPQNC                                       281 - 315
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.