Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (164)


Accession Q8NGA5 Q6IFJ2 Q96R57
Symbols OR19-28


PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

TVFTPFLSPIIFSLRNKELKNAINKNFYRKFCPPSS                                      281 - 316

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.