Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLGNGLVPWVTVF      1 - 70
RMARTVSTVCFFHLALADFMLSLSLPILVYYIVSRQWLLGEWACKLYTGFVFLTFSTSNCLLVLISVDRC     71 - 140
ISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCMQCYLQFNLENETAQMWTQEVF    141 - 210
GRQMAVIMAHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSALSAGSHLT            211 - 272
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
9653656 1998 Cloning genes encoding receptors related to chemoattractant receptors.