Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MVKAGNETQISEFLLLGFSEKQELQPFLFGLFLSMYLVTVLGNLLIILAAISDSCLHTPMYFFLSNLSFV      1 - 70
DICFASTMVPKMLVNIQTQSKVITYAGCITQMCFFVLFIVLDSLLLTVMAYDQFVAICHPLHYTVIMSPQ     71 - 140
LCGLLVLVSWIMSVLNSMLQSLVTLQLSFCTDLEIPHFFCELNEMIHLACSDTFVNNMVMHFAAVLLDGG    141 - 210
PLVGILYSYCRIVSSIRAISSTQGKYKALSTCASHLSVVSIFYGTGLGVYLSSTMTQNLHSTAVASVMYT    211 - 280
VVTPMLNPFIYSLRNKDIKGALTQFFRGKQ                                            281 - 310
//

Text Mined References (2)

PMID Year Title