Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 32.75

Knowledge Summary

Patent (151)


  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00128805537505967

AA Sequence

VTPMLNPFIYSLRNRDLKGALRKLVNRKITSSS                                         281 - 313

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.