Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 32.75

Knowledge Summary

Patent (151)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 1.3e-03

AA Sequence

MEPRNQTSASQFILLGLSEKPEQETLLFSLFFCMYLVMVVGNLLIILAISIDSHLHTPMYFFLANLSLVD      1 - 70
FCLATNTIPKMLVSLQTGSKAISYPCCLIQMYFFHFFGIVDSVIIAMMAYDRFVAICHPLHYAKIMSLRL     71 - 140
CRLLVGALWAFSCFISLTHILLMARLVFCGSHEVPHYFCDLTPILRLSCTDTSVNRIFILIVAGMVIATP    141 - 210
FVCILASYARILVAIMKVPSAGGRKKAFSTCSSHLSVVALFYGTTIGVYLCPSSVLTTVKEKASAVMYTA    211 - 280
VTPMLNPFIYSLRNRDLKGALRKLVNRKITSSS                                         281 - 313
//

Text Mined References (4)

PMID Year Title