Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.91
PubTator Score 15.13

Knowledge Summary

Patent (4,795)

Gene RIF (5)

PMID Text
26072518 results suggest non-neutral evolution for an olfactory receptor gene
22567099 Data is consistent with the idea that OR7D4 genotype predicts the sensory perception of meat containing androstenone and that genetic variation in an odorant receptor can alter food preferences.
22044667 This study suggested that OR7D4 sequence variant (rs2878329 G>A) showed evidence of association with reduced levels of adiposity (p=0.03), cognitive dietary restraint (p=0.05) and susceptibility to hunger (p=0.008).
21093532 The results suggested that odor perception between heterosexual partners may have an impact on the development of depression and anxiety, and that it might be influenced by genetic variation in OR7D4.
17873857 Genotypic variation in OR7D4 accounts for a significant proportion of the valence (pleasantness or unpleasantness) and intensity variance in perception of these steroidal odours

AA Sequence

MEAENLTELSKFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSFVD      1 - 70
ICFISTTVPKMLVSIQARSKDISYMGCLTQVYFLMMFAGMDTFLLAVMAYDRFVAICHPLHYTVIMNPCL     71 - 140
CGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNIVLYVATALLGVFP    141 - 210
VAGILFSYSQIVSSLMGMSSTKGKYKAFSTCGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSTASVMYAM    211 - 280
VTPMLNPFIYSLRNKDVKGALERLLSRADSCP                                          281 - 312
//

Text Mined References (10)

PMID Year Title
26072518 2015 Global Survey of Variation in a Human Olfactory Receptor Gene Reveals Signatures of Non-Neutral Evolution.
22567099 2012 Genetic variation of an odorant receptor OR7D4 and sensory perception of cooked meat containing androstenone.
22044667 2012 Association between olfactory receptor genes, eating behavior traits and adiposity: results from the Quebec Family Study.
21093532 2011 Odor perception between heterosexual partners: its association with depression, anxiety, and genetic variation in odorant receptor OR7D4.
17873857 2007 Genetic variation in a human odorant receptor alters odour perception.
17509148 2007 Characterizing the expression of the human olfactory receptor gene family using a novel DNA microarray.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.