Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.45
PubTator Score 15.13

Knowledge Summary

Patent (4,795)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Gene RIF (5)

AA Sequence

MEAENLTELSKFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSFVD      1 - 70
ICFISTTVPKMLVSIQARSKDISYMGCLTQVYFLMMFAGMDTFLLAVMAYDRFVAICHPLHYTVIMNPCL     71 - 140
CGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNIVLYVATALLGVFP    141 - 210
VAGILFSYSQIVSSLMGMSSTKGKYKAFSTCGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSTASVMYAM    211 - 280
VTPMLNPFIYSLRNKDVKGALERLLSRADSCP                                          281 - 312
//

Text Mined References (10)

PMID Year Title