Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.43
PubTator Score 15.10

Knowledge Summary

Patent (238)

AA Sequence

MCPLTLQVTGLMNVSEPNSSFAFVNEFILQGFSCEWTIQIFLFSLFTTTYALTITGNGAIAFVLWCDRRL      1 - 70
HTPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKNISFAGCFLQFYFFFSLGTSECLLLTVMAFDQYLA     71 - 140
ICRPLLYPNIMTGHLYAKLVILCWVCGFLWFLIPIVLISQMPFCGPNIIDHVVCDPGPRFALDCVSAPRI    141 - 210
QLFCYTLSSLVIFGNFLFIIGSYTLVLKAMLGMPSSTGRHKAFSTCGSHLAVVSLCYSSLMVMYVSPGLG    211 - 280
HSTGMQKIETLFYAMVTPLFNPLIYSLQNKEIKAALRKVLGSSNII                            281 - 326
//

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10591208 1999 The DNA sequence of human chromosome 22.