Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (79)

AA Sequence

TPMLNPIIYSLRNKEVMGALTRVIQNIFSVKM                                          281 - 312

Text Mined References (1)

PMID Year Title