Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 17.45

Knowledge Summary

Patent (69)

AA Sequence

MEMRNTTPDFILLGLFNHTRAHQVLFMMLLATVLTSLFSNALMILLIHWDHRLHRPMYFLLSQLSLMDMM      1 - 70
LVSTTVPKMAADYLTGNKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDRYAAVCHPLRYPTLMSWQLCL     71 - 140
RMTMSSWLLGAADGLLQAVATLSFPYCGAHEIDHFFCEAPVLVRLACADTSVFENAMYICCVLMLLVPFS    141 - 210
LILSSYGLILAAVLLMRSTEARKKAFATCSSHVAVVGLFYGAGIFTYMRPKSHRSTNHDKVVSAFYTMFT    211 - 280
PLLNPLIYSVRNSEVKEALKRWLGTCVNLKHQQNEAHRSR                                  281 - 320
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.