Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 17.45

Knowledge Summary

Patent (69)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

AA Sequence

MEMRNTTPDFILLGLFNHTRAHQVLFMMLLATVLTSLFSNALMILLIHWDHRLHRPMYFLLSQLSLMDMM      1 - 70
LVSTTVPKMAADYLTGNKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDRYAAVCHPLRYPTLMSWQLCL     71 - 140
RMTMSSWLLGAADGLLQAVATLSFPYCGAHEIDHFFCEAPVLVRLACADTSVFENAMYICCVLMLLVPFS    141 - 210
LILSSYGLILAAVLLMRSTEARKKAFATCSSHVAVVGLFYGAGIFTYMRPKSHRSTNHDKVVSAFYTMFT    211 - 280
PLLNPLIYSVRNSEVKEALKRWLGTCVNLKHQQNEAHRSR                                  281 - 320
//

Text Mined References (2)

PMID Year Title