Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 26.50

Knowledge Summary

Patent (80)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MEMRNTTPDFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFLLSQLSLMDMM      1 - 70
LVSTTVPKMAADYLTGSKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDRYAAVCHPLRYPTLMSWQLCL     71 - 140
RMTMSCWLLGAADGLLQAVVTLSFPYCGAHEIDHFFCETPVLVRLACADTSVFENAMYICCVLMLLVPFS    141 - 210
LILSSYGLILAAVLHMRSTEARKKAFATCSSHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFT    211 - 280
PLLNPLIYSVKNSEVKGALKRWLGTCVNIKHQQNEAHRSR                                  281 - 320
//

Text Mined References (4)

PMID Year Title