Property Summary

NCBI Gene PubMed Count 8
Grant Count 20
Funding $3,235,479.81
PubMed Score 15.21
PubTator Score 79.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.300 0.019
osteosarcoma 2.149 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.011
posterior fossa group B ependymoma -1.200 0.000
gastric carcinoma 1.100 0.012
ovarian cancer -2.000 0.000

Gene RIF (1)

PMID Text
20468071 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYTFVVRDENSSVYAEVSRLLLATGHWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADK      1 - 70
LCRKASLVKLIKTSPELAESCTWFPESYVIYPTNLKTPVAPAQNGIQPPISNSRTDEREFFLASYNRKKE     71 - 140
DGEGNVWIAKSSAGAKGEGILISSEASELLDFIDNQGQVHVIQKYLEHPLLLEPGHRKFDIRSWVLVDHQ    141 - 210
YNIYLYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFFKEFNQYLTSALNITLE    211 - 280
SSILLQIKHIIRNCLLSVEPAISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGI    281 - 350
VDIAISSVFPPPDVEQPQTQPAAFIKL                                               351 - 377
//

Text Mined References (13)

PMID Year Title
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14571137 2003 Cloning and genomic organization of the TTL gene on mouse chromosome 2 and human chromosome 2q13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...