Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.37
PubTator Score 5.61

Knowledge Summary

Patent (583)

Expression

Synonym

Accession Q8NG66 A6NHD7 Q5JPC0 Q8NG65 Q8TBY1 Q9H5F4
Symbols

Gene

PANTHER Protein Class (3)

 Collection (1)

Gene RIF (8)

PMID Text
26501353 contributes to response of colorectal cancer cells to genotoxic agents and is essential for survival either with or without exposure to DNA damage
24969318 Results show that downregulation of NEK11 in drug resistant cells might contribute to drug resistance in ovarian cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20090422 NEK11 controls degradation of CDC25A by directly phosphorylating CDC25A on residues whose phosphorylation is required for beta-TrCP mediated CDC25A polyubiquitylation and degradation.
19734889 NEK11 regulates CDC25A degradation and the IR-induced G2/M checkpoint.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15161910 Nucleolar Nek11 is a novel target of Nek2A in G1/S-arrested cells
12154088 Nek11 has a role in the S-phase checkpoint downstream of the caffeine-sensitive pathway

AA Sequence

MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNP      1 - 70
NETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFI     71 - 140
QLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYD    141 - 210
TKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIE    211 - 280
ILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKL    281 - 350
QAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE    351 - 420
ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCEES    421 - 490
DEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFN    491 - 560
SVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQ    561 - 630
LLITMGKEPTLQNHL                                                           631 - 645
//

Text Mined References (18)

PMID Year Title
26501353 2015 Loss of Nek11 Prevents G2/M Arrest and Promotes Cell Death in HCT116 Colorectal Cancer Cells Exposed to Therapeutic DNA Damaging Agents.
24969318 2014 Downregulation of NEK11 is associated with drug resistance in ovarian cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20090422 2010 NEK11: linking CHK1 and CDC25A in DNA damage checkpoint signaling.
19734889 2009 NEK11 regulates CDC25A degradation and the IR-induced G2/M checkpoint.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...