Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.60
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Tinea capitis 12 4.543 2.3

Synonym

Accession Q8NG57
Symbols HsT829
TCEB3L2

Gene

PANTHER Protein Class (1)

AA Sequence

MAAGSTTLRAVGKLQVRLATKTEPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQHVGDFARDLA      1 - 70
ARWKKLVLVDRNTGPDPQDPEESASRQRFGEALQEREKAWGFPENATAPRSPSHSPEHRRTARRTPPGQQ     71 - 140
RPHPRSPSREPRAERKRPRMAPADSGPHRDPPTRTAPLPMPEGPEPAVPGEQPGRGHAHAAQGGPLLGQG    141 - 210
CQGQPQGEAVGSHSKGHKSSRGASAQKSPPVQESQSERLQAAGADSAGPKTVPSHVFSELWDPSEAWMQA    211 - 280
NYDLLSAFEAMTSQANPEALSAPALQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRVPRNNPD    281 - 350
ALGDVEGVPYSVLEPVLEGWTPDQLYRTEKDNAALARETDELWRIHCLQDFKEEKPQEHESWRELYLRLR    351 - 420
DAREQRLRVVTTKIRSARENKPSGRQTKMICFNSVAKTPYDASRRQEKSAGAADPGNGEMEPAPKPAGSS    421 - 490
QAPSGLGDGDGGSVSGGGSSNRHAAPADKTRKQAAKKVAPLMAKAIRDYKGRFSRR                  491 - 546
//

Text Mined References (5)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11994304 2002 Identification and biochemical characterization of a novel transcription elongation factor, Elongin A3.
11932239 2002 A genome-wide screen for normally methylated human CpG islands that can identify novel imprinted genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.