Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.60
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Tinea capitis 14 4.542 2.3

Synonym

Accession Q8NG57 EloA3
Symbols EloA3C
HsT828
ELOA3L1
TCEB3CL
eloA3-like-1

Gene

AA Sequence

MAAGSTTLRAVGKLQVRLATKTEPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQHVGDFARDLA      1 - 70
ARWKKLVLVDRNTGPDPQDPEESASRQRFGEALQEREKAWGFPENATAPRSPSHSPEHRRTARRTPPGQQ     71 - 140
RPHPRSPSREPRAERKRPRMAPADSGPHRDPPTRTAPLPMPEGPEPAVPGEQPGRGHAHAAQGGPLLGQG    141 - 210
CQGQPQGEAVGSHSKGHKSSRGASAQKSPPVQESQSERLQAAGADSAGPKTVPSHVFSELWDPSEAWMQA    211 - 280
NYDLLSAFEAMTSQANPEALSAPALQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRVPRNNPD    281 - 350
ALGDVEGVPYSVLEPVLEGWTPDQLYRTEKDNAALARETDELWRIHCLQDFKEEKPQEHESWRELYLRLR    351 - 420
DAREQRLRVVTTKIRSARENKPSGRQTKMICFNSVAKTPYDASRRQEKSAGAADPGNGEMEPAPKPAGSS    421 - 490
QAPSGLGDGDGGSVSGGGSSNRHAAPADKTRKQAAKKVAPLMAKAIRDYKGRFSRR                  491 - 546
//

Text Mined References (3)

PMID Year Title