Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.86
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (2)

AA Sequence

MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSA      1 - 70
RAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKLQELSDL     71 - 140
EERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKAL    141 - 210
SDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRL    211 - 280
PELD                                                                      281 - 284
//

Text Mined References (8)

PMID Year Title