Property Summary

NCBI Gene PubMed Count 7
Grant Count 12
R01 Count 1
Funding $2,839,942.16
PubMed Score 82.78
PubTator Score 10.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.700 0.005
hepatocellular carcinoma 1.800 0.000
pancreatic cancer 1.400 0.016
osteosarcoma -1.408 0.001
tuberculosis -1.200 0.010
intraductal papillary-mucinous adenoma (... 1.400 0.008
group 4 medulloblastoma 1.100 0.004
pancreatic carcinoma 1.400 0.016
spina bifida -1.266 0.041
Pick disease 1.100 0.001
progressive supranuclear palsy 1.100 0.005
ovarian cancer -2.900 0.000

Gene RIF (4)

PMID Text
23898208 HIV-1 Tat upregulates the expression of lines homolog (LINS) in human primary T cells
23773660 Study confirms that LINS, a modulator of the WNT pathway, is an indispensable gene to human cognition and this finding sheds further light on the importance of WNT signaling in human brain development and/or function.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12119551 Human WINS1 encoded 757 AA protein. Human WINS1 mRNA was expressed in adult testis, prostate, spleen, thymus, skeletal muscle, fetal kidney & brain. This is the first report on molecular cloning & initial characterization of human WINS1.

AA Sequence

MKVFCEVLEELYKKVLLGATLENDSHDYIFYLNPAVSDQDCSTATSLEWANTCGIQGRHQPISVGVAPIA      1 - 70
VAPVCLKTNSQMSGSREVMLLQLTVIKVMTTRILSVKTEFHAKEQYRDVIKILLESAKVDSKLICMFQNS     71 - 140
DKLLSHMAAQCLALLLYFQLREKITLSNSWIAFCQKNLSEYSESNKAIYCLWTLTAIIKEIFKDSCSQKT    141 - 210
EILKQFLTHFDTIFEVFYNSLFSQHFENCRDTSKIVNILMCFLDLLELLIASRIHLKLHFTCQRILFLKP    211 - 280
SCMLEVITWPIQAFVKRKVIIFLKKCLLCKVGEDLCRGSVPALMPPDHHVAVDMLALANAVLQAVNSGLL    281 - 350
KTLSVYEKHSFFGGDEVQPECELITSPDHVILRAASLVIMKSLEIKFQNYSSASEVKVDLQRFMSELLTF    351 - 420
LKPHLQPSLQLHNPCKWLSRVFIEQDDDMLEAAKASLGIYLTLTRGCEATESLTQGKEMWDHHTHENGYN    421 - 490
PHCIFLFFLKNIGFDSTVLLDFLISSETCFLEYFVRYLKLLQKDWDNFFTICNNFDATESKYDISICGCV    491 - 560
PSLVQDQSSNQTIPHRLTAPHSHRDVCARHSWASDAPSEPLKAVMSKGAHTMCASSLSSPRASQSLVDYD    561 - 630
SSDDSDVESTEQCLANSKQTSLHQQATKEIQDAAGTSRDKKEFSLEPPSRPLVLKEFDTAFSFDCEVAPN    631 - 700
DVVSEVGIFYRIVKCFQELQDAICRLQKKNLFPYNPTALLKLLKYIEVISNKTMNTL                 701 - 757
//

Text Mined References (9)

PMID Year Title
23773660 2013 LINS, a modulator of the WNT signaling pathway, is involved in human cognition.
21937992 2011 Deep sequencing reveals 50 novel genes for recessive cognitive disorders.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119551 2002 Molecular cloning and characterization of human WINS1 and mouse Wins2, homologous to Drosophila segment polarity gene Lines (Lin).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.