Property Summary

NCBI Gene PubMed Count 17
Grant Count 105
R01 Count 34
Funding $35,397,325.16
PubMed Score 352.17
PubTator Score 90.34

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q8NG41 A0AUX9 A6NJD6 B9EJC3
Symbols L7
PPL7
PPNPB

Gene

NPB

Gene RIF (1)

PMID Text
12118011 identified a neuropeptide modified with bromine; an endogenous ligand for GPR7

AA Sequence

MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGA      1 - 70
SPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA                    71 - 125
//

Text Mined References (18)

PMID Year Title
23815761 2014 Molecular dynamics simulation of neuropeptide B and neuropeptide W in the dipalmitoylphosphatidylcholine membrane bilayer.
23515889 2013 NPBWR1 and NPBWR2: Implications in Energy Homeostasis, Pain, and Emotion.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17486669 2007 Development of a potent and selective GPR7 (NPBW1) agonist: a systematic structure-activity study of neuropeptide B.
16847439 2006 Neuropeptide B and W: neurotransmitters in an emerging G-protein-coupled receptor system.
16273281 2005 Neuropeptides B and W enhance the growth of human adrenocortical carcinoma-derived NCI-H295 cells by exerting MAPK p42/p44-mediated proliferogenic and antiapoptotic effects.
15918679 2005 NMR conformational analyses on (des-bromo) neuropeptide B [1-23] and neuropeptide W [1-23]: the importance of alpha-helices, a cation-pi interaction and a beta-turn.
15797961 2005 G protein receptors 7 and 8 are expressed in human adrenocortical cells, and their endogenous ligands neuropeptides B and w enhance cortisol secretion by activating adenylate cyclase- and phospholipase C-dependent signaling cascades.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...