Property Summary

NCBI Gene PubMed Count 17
PubMed Score 368.99
PubTator Score 90.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 3.3e-08
osteosarcoma 7950 4.3e-06
Disease Target Count Z-score Confidence
Niemann-Pick disease 14 4.47 2.2

Gene RIF (1)

AA Sequence

MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGA      1 - 70
SPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA                    71 - 125
//

Text Mined References (18)

PMID Year Title