Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.76

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
21861459 Defensin-beta 105 displays antimicrobial activity against S. aureus and E. coli, among other bacteria.

AA Sequence

MALIRKTFYFLFAMFFILVQLPSGCQAGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLN      1 - 70
FLCCRQRI                                                                   71 - 78
//

Text Mined References (10)

PMID Year Title
21861459 2011 Human defensin 5 disulfide array mutants: disulfide bond deletion attenuates antibacterial activity against Staphylococcus aureus.
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
15727258 2004 Evidence for duplication of the human defensin gene DEFB4 in chromosomal region 8p22-23 and implications for the analysis of SNP allele distribution.
15588320 2004 Polymorphic segmental duplications at 8p23.1 challenge the determination of individual defensin gene repertoires and the assembly of a contiguous human reference sequence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12916016 2003 Extensive normal copy number variation of a beta-defensin antimicrobial-gene cluster.
12734011 2003 Duplication and selection in the evolution of primate beta-defensin genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193721 2002 Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.