Property Summary

NCBI Gene PubMed Count 9
PubMed Score 15.34

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MALIRKTFYFLFAMFFILVQLPSGCQAGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLN      1 - 70
FLCCRQRI                                                                   71 - 78
//

Text Mined References (10)

PMID Year Title