Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.99
PubTator Score 6.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.321 6.5e-03
active ulcerative colitis 1.140 1.8e-02
ependymoma -1.300 4.6e-02
invasive ductal carcinoma -1.200 2.9e-03
medulloblastoma, large-cell -1.100 7.2e-03
osteosarcoma 2.322 1.1e-06
ovarian cancer -1.100 2.3e-03
psoriasis 1.900 8.9e-05
subependymal giant cell astrocytoma -1.745 3.3e-02

 IMPC Phenotype (1)

 MGI Phenotype (1)

 GWAS Trait (2)

Protein-protein Interaction (8)

Gene RIF (4)

AA Sequence

MGQESSKPVWPNPTGGYQSNTGRRYGRRHAYVSFRPPTSQRERIASQRKTNSEVPMHRSAPSQTTKRSRS      1 - 70
PFSTTRRSWDDSESSGTNLNIDNEDYSRYPPREYRASGSRRGMAYGHIDSYGADDSEEEGAGPVERPPVR     71 - 140
GKTGKFKDDKLYDPEKGARSLAGPPPHFSSFSRDVREERDKLDPVPAARCSASRADFLPQSSVASQSSSE    141 - 210
GKLATKGDSSERERREQNLPARPSRAPVSICGGGENTSKSAEEPVVRPKIRNLASPNCVKPKIFFDTDDD    211 - 280
DDMPHSTSRWRDTANDNEGHSDGLARRGRGESSSGYPEPKYPEDKREARSDQVKPEKVPRRRRTMADPDF    281 - 350
WTHSDDYYKYCDEDSDSDKEWIAALRRKYRSREQTLSSSGESWETLPGKEEREPPQAKVSASTGTSPGPG    351 - 420
ASASAGAGAGASAGSNGSNYLEEVREPSLQEEQASLEEGEIPWLQYHENDSSSEGDNDSGHELMQPGVFM    421 - 490
LDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAV    491 - 560
DVEVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSG    561 - 630
TCPVCRCMFPPPL                                                             631 - 643
//

Text Mined References (19)

PMID Year Title