Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.04
PubTator Score 6.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.10659549285141E-6
ulcerative colitis 2087 3.80943628739127E-6
psoriasis 6685 8.94394374882903E-5
ovarian cancer 8492 0.00228928055356841
invasive ductal carcinoma 2950 0.00294125875616246
active Crohn's disease 918 0.00645652962995038
medulloblastoma, large-cell 6234 0.00716097775294084
subependymal giant cell astrocytoma 2287 0.0330407960034533
ependymoma 2514 0.0462339319825021

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.300 0.046
psoriasis 1.900 0.000
osteosarcoma 2.322 0.000
medulloblastoma, large-cell -1.100 0.007
active Crohn's disease 1.321 0.006
ulcerative colitis 1.200 0.000
subependymal giant cell astrocytoma -1.745 0.033
invasive ductal carcinoma -1.200 0.003
ovarian cancer -1.100 0.002

Synonym

Accession Q8NG27 A2A322 Q5JUT8 Q5JUT9 Q8NG28 Q9HAC1 Praja1
Symbols RNF70
PRAJA1

Gene

PANTHER Protein Class (2)

PDB

2L0B  

  Ortholog (1)

Species Source
Mouse OMA Inparanoid

 MGI Term (1)

Gene RIF (4)

PMID Text
21513699 these results suggest a role for PRAJA1 in regulating the level of PRC2 by targeting its free subunits for Ub-mediated proteasomal degradation.
21461837 Data provide clues into novel aspects of Praja1 function.
12036302 Involved in protein ubiquitination in the brain. Candidate gene for X-linked mental retardation.
11959851 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.

AA Sequence

MGQESSKPVWPNPTGGYQSNTGRRYGRRHAYVSFRPPTSQRERIASQRKTNSEVPMHRSAPSQTTKRSRS      1 - 70
PFSTTRRSWDDSESSGTNLNIDNEDYSRYPPREYRASGSRRGMAYGHIDSYGADDSEEEGAGPVERPPVR     71 - 140
GKTGKFKDDKLYDPEKGARSLAGPPPHFSSFSRDVREERDKLDPVPAARCSASRADFLPQSSVASQSSSE    141 - 210
GKLATKGDSSERERREQNLPARPSRAPVSICGGGENTSKSAEEPVVRPKIRNLASPNCVKPKIFFDTDDD    211 - 280
DDMPHSTSRWRDTANDNEGHSDGLARRGRGESSSGYPEPKYPEDKREARSDQVKPEKVPRRRRTMADPDF    281 - 350
WTHSDDYYKYCDEDSDSDKEWIAALRRKYRSREQTLSSSGESWETLPGKEEREPPQAKVSASTGTSPGPG    351 - 420
ASASAGAGAGASAGSNGSNYLEEVREPSLQEEQASLEEGEIPWLQYHENDSSSEGDNDSGHELMQPGVFM    421 - 490
LDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAV    491 - 560
DVEVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSG    561 - 630
TCPVCRCMFPPPL                                                             631 - 643
//

Text Mined References (19)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21513699 2011 PRAJA1 is a ubiquitin ligase for the polycomb repressive complex 2 proteins.
21461837 2011 Protein microarrays for the identification of praja1 e3 ubiquitin ligase substrates.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17941886 2007 Contiguous gene deletions involving EFNB1, OPHN1, PJA1 and EDA in patients with craniofrontonasal syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...