Property Summary

NCBI Gene PubMed Count 16
Grant Count 12
R01 Count 6
Funding $757,950.14
PubMed Score 7.04
PubTator Score 6.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.300 0.046
psoriasis 1.900 0.000
osteosarcoma 2.322 0.000
medulloblastoma, large-cell -1.100 0.007
active Crohn's disease 1.321 0.006
ulcerative colitis 1.200 0.000
subependymal giant cell astrocytoma -1.745 0.033
invasive ductal carcinoma -1.200 0.003
ovarian cancer -1.100 0.002

Gene RIF (4)

PMID Text
21513699 these results suggest a role for PRAJA1 in regulating the level of PRC2 by targeting its free subunits for Ub-mediated proteasomal degradation.
21461837 Data provide clues into novel aspects of Praja1 function.
12036302 Involved in protein ubiquitination in the brain. Candidate gene for X-linked mental retardation.
11959851 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.

AA Sequence

MGQESSKPVWPNPTGGYQSNTGRRYGRRHAYVSFRPPTSQRERIASQRKTNSEVPMHRSAPSQTTKRSRS      1 - 70
PFSTTRRSWDDSESSGTNLNIDNEDYSRYPPREYRASGSRRGMAYGHIDSYGADDSEEEGAGPVERPPVR     71 - 140
GKTGKFKDDKLYDPEKGARSLAGPPPHFSSFSRDVREERDKLDPVPAARCSASRADFLPQSSVASQSSSE    141 - 210
GKLATKGDSSERERREQNLPARPSRAPVSICGGGENTSKSAEEPVVRPKIRNLASPNCVKPKIFFDTDDD    211 - 280
DDMPHSTSRWRDTANDNEGHSDGLARRGRGESSSGYPEPKYPEDKREARSDQVKPEKVPRRRRTMADPDF    281 - 350
WTHSDDYYKYCDEDSDSDKEWIAALRRKYRSREQTLSSSGESWETLPGKEEREPPQAKVSASTGTSPGPG    351 - 420
ASASAGAGAGASAGSNGSNYLEEVREPSLQEEQASLEEGEIPWLQYHENDSSSEGDNDSGHELMQPGVFM    421 - 490
LDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAV    491 - 560
DVEVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSG    561 - 630
TCPVCRCMFPPPL                                                             631 - 643
//

Text Mined References (19)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21513699 2011 PRAJA1 is a ubiquitin ligase for the polycomb repressive complex 2 proteins.
21461837 2011 Protein microarrays for the identification of praja1 e3 ubiquitin ligase substrates.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17941886 2007 Contiguous gene deletions involving EFNB1, OPHN1, PJA1 and EDA in patients with craniofrontonasal syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...