Property Summary

NCBI Gene PubMed Count 9
Grant Count 39
R01 Count 26
Funding $7,870,241.05
PubMed Score 596.54
PubTator Score 21.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
gastric cancer 1.100 0.019
osteosarcoma 1.278 0.010

Gene RIF (5)

PMID Text
26774285 Conclude that mammalian DNA end resection triggers its own inhibition via the recruitment of HELB.
25933514 The depletion of HDHB from human cells diminishes Cdc45 association with chromatin, suggesting that HDHB may facilitate Cdc45 recruitment at G1/S in human cells.
25617833 HDHB promotes homologous recombination in vivo and stimulates 5'-3' heteroduplex extension during Rad51-mediated strand exchange in vitro
22194613 Replication stress-induced recruitment of HDHB to chromatin is independent of checkpoint signaling but correlates with the level of replication protein A (RPA) recruited to chromatin.
12181327 role of dominant-negative mutant in blocking onset of chromosomal DNA replication

AA Sequence

MARSSPYLRQLQGPLLPPRDLVEEDDDYLNDDVEEDEESVFIDAEELCSGGVKAGSLPGCLRVSICDENT      1 - 70
QETCKVFGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHICALFLKECEVSSDD     71 - 140
VNKFLTWVKEVSNYKNLNFENLRETLRTFHKETGRKDQKQPTQNGQEELFLDNEMSLPLENTIPFRNVMT    141 - 210
ALQFPKIMEFLPVLLPRHFKWIIGSGSKEMLKEIEEILGTHPWKLGFSKITYREWKLLRCEASWIAFCQC    211 - 280
ESLLQLMTDLEKNALIMYSRLKQICREDGHTYVEVNDLTLTLSNHMSFHAASESLKFLKDIGVVTYEKSC    281 - 350
VFPYDLYHAERAIAFSICDLMKKPPWHLCVDVEKVLASIHTTKPENSSDDALNESKPDEVRLENPVDVVD    351 - 420
TQDNGDHIWTNGENEINAEISEVQLDQDQVEVPLDRDQVAALEMICSNPVTVISGKGGCGKTTIVSRLFK    421 - 490
HIEQLEEREVKKACEDFEQDQNASEEWITFTEQSQLEADKAIEVLLTAPTGKAAGLLRQKTGLHAYTLCQ    491 - 560
VNYSFYSWTQTMMTTNKPWKFSSVRVLVVDEGSLVSVGIFKSVLNLLCEHSKLSKLIILGDIRQLPSIEP    561 - 630
GNLLKDLFETLKSRNCAIELKTNHRAESQLIVDNATRISRRQFPKFDAELNISDNPTLPISIQDKTFIFV    631 - 700
RLPEEDASSQSSKTNHHSCLYSAVKTLLQENNLQNAKTSQFIAFRRQDCDLINDCCCKHYTGHLTKDHQS    701 - 770
RLVFGIGDKICCTRNAYLSDLLPENISGSQQNNDLDASSEDFSGTLPDFAKNKRDFESNVRLCNGEIFFI    771 - 840
TNDVTDVTFGKRRSLTINNMAGLEVTVDFKKLMKYCRIKHAWARTIHTFQGSEEQTVVYVVGKAGRQHWQ    841 - 910
HVYTAVTRGRCRVYVIAEESQLRNAIMKNSFPRKTRLKHFLQSKLSSSGAPPADFPSPRKSSGDSGGPST    911 - 980
PSASPLPVVTDHAMTNDVTWSEASSPDERTLTFAERWQLSSPDGVDTDDDLPKSRASKRTCGVNDDESPS    981 - 1050
KIFMVGESPQVSSRLQNLRLNNLIPRQLFKPTDNQET                                    1051 - 1087
//

Text Mined References (15)

PMID Year Title
26774285 2016 HELB Is a Feedback Inhibitor of DNA End Resection.
25933514 2015 Human DNA helicase B interacts with the replication initiation protein Cdc45 and facilitates Cdc45 binding onto chromatin.
25617833 2015 Human DNA helicase B functions in cellular homologous recombination and stimulates Rad51-mediated 5'-3' heteroduplex extension in vitro.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22194613 2012 Human DNA helicase B (HDHB) binds to replication protein A and facilitates cellular recovery from replication stress.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15146062 2004 Cell cycle-dependent regulation of a human DNA helicase that localizes in DNA damage foci.
More...