Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 2
Funding $411,493.66
PubMed Score 15.85
PubTator Score 19.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer 1.300 0.016
malignant mesothelioma -2.600 0.000
tuberculosis 1.500 0.004
group 3 medulloblastoma 2.600 0.001
pancreatic carcinoma 1.300 0.016
psoriasis 1.100 0.000
facioscapulohumeral dystrophy 2.200 0.007

Gene RIF (1)

PMID Text
18187620 Knockdown of tripartite motif containing 58 (TRIM58) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQCRGPFRPSGFR      1 - 70
PNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDAGPEHRTHRTAPLQEAAGSYQ     71 - 140
VKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERA    141 - 210
TLQRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIP    211 - 280
GRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEV    281 - 350
LVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAG    351 - 420
EISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL        421 - 486
//

Text Mined References (7)

PMID Year Title
25241935 2014 Trim58 degrades Dynein and regulates terminal erythropoiesis.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.