Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.48
PubTator Score 19.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
facioscapulohumeral dystrophy 2.200 6.6e-03
group 3 medulloblastoma 2.600 7.8e-04
malignant mesothelioma -2.600 2.7e-06
pancreatic cancer 1.300 1.6e-02
pancreatic carcinoma 1.300 1.6e-02
psoriasis 1.100 4.9e-20
tuberculosis 1.500 4.4e-03

Gene RIF (1)

AA Sequence

MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQCRGPFRPSGFR      1 - 70
PNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDAGPEHRTHRTAPLQEAAGSYQ     71 - 140
VKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERA    141 - 210
TLQRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIP    211 - 280
GRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEV    281 - 350
LVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAG    351 - 420
EISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL        421 - 486
//

Text Mined References (7)

PMID Year Title