Property Summary

NCBI Gene PubMed Count 11
Grant Count 20
R01 Count 15
Funding $955,432.1
PubMed Score 13.49
PubTator Score 9.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25893857 Necl-4 serves as a novel regulator for contact inhibition of cell movement and proliferation cooperatively with the VEGF receptor and PTPN13
23825401 Cadm4 regulates the growth of the myelin unit and the organization of the underlying axonal membrane.
23611113 results indicate that Necl-4 serves as a tumor suppressor by inhibiting the ErbB2/ErbB3 signaling and hemidesmosome disassembly
23559354 Loss or decrease of CADM4 expression seems to play an important role in breast cancer invasiveness, and it is associated with poorer biological parameters.
21544807 CADM4, as well as 4.1B is expressed specifically in human proximal tubules.
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19565570 Nec- 4 suppress the growth and tumorigenic ability of colon cancer cells.
16261159 TSLL2 is expressed at the cell-cell attachment sites in the renal tubules, the transitional epithelia of the bladder, and the glandular epithelia of the prostate, and is a tumor-suppressor candidate in prostate cancer.

AA Sequence

MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTR      1 - 70
ALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGE     71 - 140
VELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGH    141 - 210
SKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPG    211 - 280
LVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVR    281 - 350
QKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKEEFFI                                    351 - 388
//

Text Mined References (13)

PMID Year Title
25893857 2015 The Cell Adhesion Molecule Necl-4/CADM4 Serves as a Novel Regulator for Contact Inhibition of Cell Movement and Proliferation.
23825401 2013 Genetic deletion of Cadm4 results in myelin abnormalities resembling Charcot-Marie-Tooth neuropathy.
23611113 2013 Interaction of Necl-4/CADM4 with ErbB3 and integrin ?6 ?4 and inhibition of ErbB2/ErbB3 signaling and hemidesmosome disassembly.
23559354 2013 Clinicopathological significance of CADM4 expression in invasive ductal carcinoma of the breast.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21544807 2012 Aberrations of a cell adhesion molecule CADM4 in renal clear cell carcinoma.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
19565570 2009 The cell adhesion nectin-like molecules (Necl) 1 and 4 suppress the growth and tumorigenic ability of colon cancer cells.
16261159 2006 Cell adhesion and prostate tumor-suppressor activity of TSLL2/IGSF4C, an immunoglobulin superfamily molecule homologous to TSLC1/IGSF4.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...