Property Summary

NCBI Gene PubMed Count 33
PubMed Score 22.35
PubTator Score 27.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.100 3.6e-03
astrocytoma 1.200 3.8e-21
Astrocytoma, Pilocytic 1.100 3.5e-05
Atopic dermatitis 1.100 4.7e-05
glioblastoma 1.100 1.2e-05
ovarian cancer 2.200 6.0e-07
psoriasis 2.000 8.2e-05
subependymal giant cell astrocytoma 1.023 3.3e-02

Protein-protein Interaction (3)

Gene RIF (19)

AA Sequence

MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQ      1 - 70
VARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAAS     71 - 140
DVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEEN    141 - 210
RLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQ    211 - 280
ELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAG    281 - 350
RIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEEL    351 - 420
LRHVAECCQ                                                                 421 - 429
//

Text Mined References (37)

PMID Year Title