Property Summary

NCBI Gene PubMed Count 29
PubMed Score 19.53
PubTator Score 27.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 2.000 0.000
astrocytoma 1.200 0.000
glioblastoma multiforme 1.300 0.000
Atopic dermatitis 1.100 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.100 0.000
subependymal giant cell astrocytoma 1.023 0.033
ovarian cancer 2.200 0.000

Synonym

Accession Q8NFZ5 B1AKS4 B3KTY8 D3DVQ9 Q7L5L2 Q9BQR6 Q9H682
Symbols KLIP
ABIN2
FLIP1

Gene

Gene RIF (15)

PMID Text
26348204 miR let-7a-regulated USP35 can inhibit NF-kappaB activation by deubiquitination and stabilization of ABIN-2 protein
21784860 ABIN-2 acts as a positive regulator of NF-kappaB-dependent transcription by activating IKKalpha.
21266526 A20, ABIN-1/2, and CARD11 mutations have prognostic value in gastrointestinal diffuse large B-cell lymphoma
19898481 Observational study of gene-disease association. (HuGE Navigator)
19464428 This review defines ABIN-2 based on three different parameters: ability to bind A20; ability to inhibit NF-kappaB activation upon overexpression; the presence of specific short amino acid regions of strong homology, designated ABIN homology domains.
18622428 role for an ABIN-sensitive non-classical NF-kappaB signalling pathway in the proliferation of EGFR-overexpressing tumour cells.
17038805 Thus the present results showed a correlation between NF-kappaB activation and the repair of sublethal damage in split-dose irradiation.
16554025 Thus, CIH-mediated NF-kappaB activation may be a molecular mechanism linking OSA and cardiovascular pathologies seen in OSA patients.
16480954 ABIN-2 may function as a negative regulator that downregulates NF-kappaB activation during liver regeneration
15169888 optimal TPL-2 stability in vivo requires interaction with ABIN-2 as well as p105
More...

AA Sequence

MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQ      1 - 70
VARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAAS     71 - 140
DVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEEN    141 - 210
RLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQ    211 - 280
ELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAG    281 - 350
RIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEEL    351 - 420
LRHVAECCQ                                                                 421 - 429
//

Text Mined References (33)

PMID Year Title
26348204 2015 USP35 activated by miR let-7a inhibits cell proliferation and NF-?B activation through stabilization of ABIN-2.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21784860 2011 A20-binding inhibitor of nuclear factor-kappaB (NF-kappaB)-2 (ABIN-2) is an activator of inhibitor of NF-kappaB (IkappaB) kinase alpha (IKKalpha)-mediated NF-kappaB transcriptional activity.
21266526 2011 A20, ABIN-1/2, and CARD11 mutations and their prognostic value in gastrointestinal diffuse large B-cell lymphoma.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19464428 2009 ABINs: A20 binding inhibitors of NF-kappa B and apoptosis signaling.
More...