Property Summary

NCBI Gene PubMed Count 20
PubMed Score 50.39
PubTator Score 20.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
ovarian cancer 8519 9.7e-08
posterior fossa group B ependymoma 416 4.4e-07
osteosarcoma 7950 3.5e-06
group 3 medulloblastoma 4104 4.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Autistic Disorder 364 4.51 2.3

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.200 4.8e-04
osteosarcoma 1.543 3.5e-06
ovarian cancer 1.800 9.7e-08
posterior fossa group B ependymoma -1.100 4.4e-07

Gene RIF (8)

AA Sequence

MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNNEILGPVVQFL      1 - 70
GVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSED     71 - 140
CLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVA    141 - 210
TLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHS    211 - 280
EGLFQKAIAQSGTAISSWSVNYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIA    281 - 350
FGPVVDGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY    351 - 420
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQAE    421 - 490
GRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHT    491 - 560
KPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAFWLELVPHLHNLHTELFTTTTRLPPYATRWP    561 - 630
PRPPAGAPGTRRPPPPATLPPEPEPEPGPRAYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYK    631 - 700
RDRRQELRCRRLSPPGGSGSGVPGGGPLLPAAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYT    701 - 770
LALRRAPDDVPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV         771 - 835
//

Text Mined References (23)

PMID Year Title