Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.61
PubTator Score 2.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
25558953 Expression of NLGN4Y, a gene that may be involved in synaptic function, is increased in boys with XYY
19605777 investigated 12 single-nucleotide polymorphisms in Y-linked neuroligin 4, transducin b-like 1, and eukaryotic translation initiation factor 1a genes, results suggest a Y chromosome effect in autism
19605777 Observational study of gene-disease association. (HuGE Navigator)
18628683 The coding sequences and splice junctions of the NLGN4Y gene were analyzed in 335 male samples (290 with autism and 45 with mental retardation) to analyze sequence variants in NLGN4Y that are associated with autism or mental retardation.
16077734 Neuroligin mutations most probably represent rare causes of autism; it is unlikely that the allelic variants in any of these genes would be major risk factors for autism.

AA Sequence

MLRPQGLLWLPLLFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNTNYGKIQGLRTPLPSEILGPV      1 - 70
EQYLGVPYASPPTGERRFQPPESPSSWTGIRNATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQ     71 - 140
DQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGF    141 - 210
LSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQS    211 - 280
GTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIP    281 - 350
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI    351 - 420
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHG    421 - 490
DEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWS    491 - 560
KYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPA    561 - 630
KIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK    631 - 700
DKRRHETHRHPSPQRNTTNDITHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDD    701 - 770
IPFMTPNTITMIPNTLMGMQPLHTFKTFSGGQNSTNLPHGHSTTRV                            771 - 816
//

Text Mined References (16)

PMID Year Title
25558953 2015 Behavioral phenotypes in males with XYY and possible role of increased NLGN4Y expression in autism features.
19605777 2009 Association of Y chromosome haplotypes with autism.
18923512 2008 Neuroligins and neurexins link synaptic function to cognitive disease.
18628683 2008 Analysis of the neuroligin 4Y gene in patients with autism.
18227507 2008 Reduced social interaction and ultrasonic communication in a mouse model of monogenic heritable autism.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17292328 2007 Neuroligins 3 and 4X interact with syntrophin-gamma2, and the interactions are affected by autism-related mutations.
16077734 2005 Analysis of four neuroligin genes as candidates for autism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...