Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.23
PubTator Score 2.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 1.6e-02
cystic fibrosis -1.200 9.1e-04
ependymoma -1.200 5.6e-03
glioblastoma -1.200 3.3e-02
medulloblastoma, large-cell -1.100 1.1e-02
pediatric high grade glioma -1.800 1.4e-03
sonic hedgehog group medulloblastoma -1.200 1.6e-02
subependymal giant cell astrocytoma -1.389 2.6e-03
X-linked cerebral adrenoleukodystrophy 1.700 6.9e-03

Gene RIF (5)

AA Sequence

MLRPQGLLWLPLLFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNTNYGKIQGLRTPLPSEILGPV      1 - 70
EQYLGVPYASPPTGERRFQPPESPSSWTGIRNATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQ     71 - 140
DQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGF    141 - 210
LSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQS    211 - 280
GTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIP    281 - 350
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI    351 - 420
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHG    421 - 490
DEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWS    491 - 560
KYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPA    561 - 630
KIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK    631 - 700
DKRRHETHRHPSPQRNTTNDITHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDD    701 - 770
IPFMTPNTITMIPNTLMGMQPLHTFKTFSGGQNSTNLPHGHSTTRV                            771 - 816
//

Text Mined References (17)

PMID Year Title