Property Summary

NCBI Gene PubMed Count 21
Grant Count 9
R01 Count 6
Funding $770,009.25
PubMed Score 16.08
PubTator Score 11.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (12)

PMID Text
25585578 FBH1 acts as a negative regulator of RAD51 function in human cells
24108124 FBH1 restraining RAD51 DNA binding under unperturbed growth conditions to prevent unwanted or unscheduled DNA recombination.
23677613 The study reports a mechanism that controls the degradation of FBH1 after DNA damage.
23466708 FBH1 inactivation appears to contribute to oncogenic transformation by allowing survival of cells undergoing replicative stress due to external factors such as UV irradiation.
23393192 Ubiquitylation affects FBH1 interaction with the RAD51 nucleoprotein filament, but not its translocase and helicase activities.
23361013 FBH1 helicase activity is required to eliminate cells with excessive replication stress through the generation of MUS81-induced DNA double-strand breaks.
23319600 FBH1 helicase activity is required for the efficient induction of DSBs and apoptosis specifically in response to DNA replication stress.
19736316 Data show that the human Fbh1 (hFbh1) helicase accumulates at sites of DNA damage or replication stress in a manner dependent fully on its helicase activity and partially on its conserved F box.
18187620 Knockdown of F-box protein, helicase 18 (FBXO18) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17724085 These findings suggest that the hFBH1 helicase is a functional human orthologue of budding yeast Srs2 that also possesses self-regulation properties necessary to execute its recombination functions.
More...

AA Sequence

MRRFKRKHLTAIDCQHLARSHLAVTQPFGQRWTNRDPNHGLYPKPRTKRGSRGQGSQRCIPEFFLAGKQP      1 - 70
CTNDMAKSNSVGQDSCQDSEGDMIFPAESSCALPQEGSAGPGSPGSAPPSRKRSWSSEEESNQATGTSRW     71 - 140
DGVSKKAPRHHLSVPCTRPREARQEAEDSTSRLSAESGETDQDAGDVGPDPIPDSYYGLLGTLPCQEALS    141 - 210
HICSLPSEVLRHVFAFLPVEDLYWNLSLVCHLWREIISDPLFIPWKKLYHRYLMNEEQAVSKVDGILSNC    211 - 280
GIEKESDLCVLNLIRYTATTKCSPSVDPERVLWSLRDHPLLPEAEACVRQHLPDLYAAAGGVNIWALVAA    281 - 350
VVLLSSSVNDIQRLLFCLRRPSSTVTMPDVTETLYCIAVLLYAMREKGINISNRIHYNIFYCLYLQENSC    351 - 420
TQATKVKEEPSVWPGKKTIQLTHEQQLILNHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSQSRFLYVTF    421 - 490
NKSIAKQAERVFPSNVICKTFHSMAYGHIGRKYQSKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKTL    491 - 560
ENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVLEASRLWDNMRKLGECTEEAHQMTHDGYLKL    561 - 630
WQLSKPSLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQ    631 - 700
SFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDAKGQVALLSRTNANVFDEAVRVTEGEFPSRI    701 - 770
HLIGGIKSFGLDRIIDIWILLQPEEERRKQNLVIKDKFIRRWVHKEGFSGFKRYVTAAEDKELEAKIAVV    771 - 840
EKYNIRIPELVQRIEKCHIEDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLPQLPHFRVESF    841 - 910
SEDEWNLLYVAVTRAKKRLIMTKSLENILTLAGEYFLQAELTSNVLKTGVVRCCVGQCNNAIPVDTVLTM    911 - 980
KKLPITYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVRAMERTVENIVLPRHEALLFLVF           981 - 1043
//

Text Mined References (24)

PMID Year Title
25772361 2015 FBH1 Catalyzes Regression of Stalled Replication Forks.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
24108124 2013 FBH1 helicase disrupts RAD51 filaments in vitro and modulates homologous recombination in mammalian cells.
23954233 2013 Cysteine mutations cause defective tyrosine phosphorylation in MEGF10 myopathy.
23677613 2013 The helicase FBH1 is tightly regulated by PCNA via CRL4(Cdt2)-mediated proteolysis in human cells.
23466708 2013 FBH1 protects melanocytes from transformation and is deregulated in melanomas.
23393192 2013 Single-molecule sorting reveals how ubiquitylation affects substrate recognition and activities of FBH1 helicase.
23361013 2013 FBH1 co-operates with MUS81 in inducing DNA double-strand breaks and cell death following replication stress.
23319600 2013 FBH1 promotes DNA double-strand breakage and apoptosis in response to DNA replication stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...