Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.29
PubTator Score 3.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease 1.184 6.3e-03
active ulcerative colitis 1.341 3.8e-03
adult high grade glioma -1.800 8.8e-04
astrocytic glioma -2.500 3.6e-03
Astrocytoma, Pilocytic -1.200 2.8e-03
Atopic dermatitis -1.800 9.0e-04
atypical teratoid / rhabdoid tumor -2.400 5.3e-06
Breast cancer -1.100 6.6e-04
chronic rhinosinusitis -1.334 1.1e-02
cystic fibrosis -3.022 9.0e-08
ductal carcinoma in situ -1.600 3.3e-02
ependymoma -2.800 5.9e-03
facioscapulohumeral dystrophy -1.400 2.5e-02
glioblastoma -1.600 1.8e-05
group 3 medulloblastoma -2.700 1.9e-04
interstitial cystitis -1.500 4.3e-03
intraductal papillary-mucinous adenoma (... -1.400 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.300 1.2e-02
lung adenocarcinoma -2.100 1.9e-16
lung cancer 1.400 4.6e-02
medulloblastoma, large-cell -2.600 5.2e-04
non primary Sjogren syndrome sicca 1.100 3.4e-02
non-small cell lung cancer -1.966 5.9e-13
oligodendroglioma -2.100 9.1e-03
osteosarcoma 2.302 2.7e-03
ovarian cancer 1.100 4.2e-02
pancreatic cancer -1.100 5.1e-03
primary pancreatic ductal adenocarcinoma -1.053 1.5e-02
primitive neuroectodermal tumor -2.200 2.7e-03
psoriasis -1.200 2.9e-02
spina bifida -2.081 2.7e-02
subependymal giant cell astrocytoma -1.409 2.4e-02
type II diabetes mellitus and post-ische... -1.200 3.0e-02

Synonym

Accession Q8NFX7 D3DS78 Q8N3H1 Q8N8D5 Q96GF3 Q9P008
Symbols amisyn
HSPC156

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (13)

Gene RIF (2)

AA Sequence

MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQASITKVKQFEG      1 - 70
STSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPE     71 - 140
FINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLKNSAQQFAETAHKLAMKHKC    141 - 210
//

Text Mined References (16)

PMID Year Title