Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.97
PubTator Score 3.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Autistic Disorder 320
Disease Target Count P-value
psoriasis 6685 9.83161130445607E-35
non-small cell lung cancer 2798 1.37818354560013E-25
lung adenocarcinoma 2714 2.50552754505374E-25
oligodendroglioma 2849 2.28952097975752E-12
ependymoma 2514 4.22174619875561E-12
cystic fibrosis 1670 2.44537577828723E-8
atypical teratoid / rhabdoid tumor 4369 1.19829197189518E-5
pediatric high grade glioma 2712 2.57099527100439E-5
group 3 medulloblastoma 2254 3.16750101859918E-5
medulloblastoma, large-cell 6234 4.87790006629936E-5
glioblastoma 5572 1.34357830787473E-4
interstitial cystitis 2299 6.08998437205836E-4
Breast cancer 3099 6.60010165975608E-4
Atopic dermatitis 944 8.95699153945463E-4
primitive neuroectodermal tumor 3031 0.0038155956813118
active ulcerative colitis 477 0.00384655758276406
pilocytic astrocytoma 3086 0.00508612646086686
pancreatic cancer 2300 0.00513577625120201
astrocytic glioma 2241 0.00885972584416244
osteosarcoma 7933 0.00927156998026421
chronic rhinosinusitis 512 0.0108100600182067
non primary Sjogren syndrome sicca 840 0.0113307809992084
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0116090593970996
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0116674341434689
active Crohn's disease 918 0.014017605921509
primary pancreatic ductal adenocarcinoma 1271 0.0146524888716066
ovarian cancer 8492 0.0182310176418452
subependymal giant cell astrocytoma 2287 0.0243595531379919
facioscapulohumeral dystrophy 286 0.0248992275955889
spina bifida 1064 0.026905982052635
type II diabetes mellitus and post-ischemic heart failure 89 0.0303279827560867
ductal carcinoma in situ 1745 0.0334660062651599
lung cancer 4473 0.0456083054461045

Expression

Synonym

Accession Q8NFX7 D3DS78 Q8N3H1 Q8N8D5 Q96GF3 Q9P008
Symbols amisyn
HSPC156

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (2)

PMID Text
22685579 Data suggest that genetic variations within CD6 and syntaxin binding protein 6 (STXBP6) may influence response to TNFalpha inhibitors in patients with rheumatoid arthritis (RA).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQASITKVKQFEG      1 - 70
STSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPE     71 - 140
FINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLKNSAQQFAETAHKLAMKHKC    141 - 210
//

Text Mined References (16)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22685579 2012 CD6 and syntaxin binding protein 6 variants and response to tumor necrosis factor alpha inhibitors in Danish patients with rheumatoid arthritis.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...