Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.58
PubTator Score 11.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 5.32182836122109E-11
lung adenocarcinoma 2714 2.52618884258655E-10
medulloblastoma, large-cell 6234 2.53982671565216E-7
atypical teratoid / rhabdoid tumor 4369 9.1563197193134E-7
pancreatic cancer 2300 9.51491848324714E-6
primitive neuroectodermal tumor 3031 4.98348764807883E-5
sonic hedgehog group medulloblastoma 1482 1.23463539903801E-4
adult high grade glioma 2148 1.48052976878293E-4
glioblastoma 5572 2.65673065250536E-4
lung cancer 4473 2.72769431658973E-4
ductal carcinoma in situ 1745 6.62534565392209E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.32944538979193E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00108810415152006
pilocytic astrocytoma 3086 0.00257585498182406
astrocytic glioma 2241 0.00686167863536541
ependymoma 2514 0.00829229544635794
invasive ductal carcinoma 2950 0.00832191993257858
oligodendroglioma 2849 0.00973826053847186
active Crohn's disease 918 0.0137416606097156
osteosarcoma 7933 0.0169197429862869
gastric carcinoma 832 0.0271180882892656
Disease Target Count Z-score Confidence
Lymphoid leukemia 69 0.0 2.0
Disease Target Count Z-score Confidence
Azoospermia 89 3.042 1.5

Expression

Gene RIF (11)

PMID Text
26675235 The role of MyRIP in Ca(2+)-driven exocytosis requires both MyoVa- and actin-binding potential.
22396429 Myrip couples the retention of secretory granules in the cell cortex, their transport to the plasma membrane, and their attachment to the plasma membrane, thus promoting secretion.
21740491 A Rab27a/MyRIP/myosin Va complex is involved in linking von-Willebrand factor (Vwf) to the peripheral actin cytoskeleton of endothelial cells to allow full maturation and prevent premature secretion of vWF.
20861866 A new potentially protective effect was identified at rs2679798 in MYRIP.
20861866 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19270261 Rab27a and MyRIP regulate the amount and multimeric state of VWF released from endothelial cells.
18478159 During primate spermiogenesis, dynein, myosin Va, MyRIP and Rab27b that compose microtubule-based and actin-based vesicle transport systems are actually present in the manchette and might possibly be involved in intramanchette transport.
14517322 Slac2c/MyRIP is part of a complex mediating the interaction of secretory granules with cortical actin cytoskeleton
12221080 Slac2-c/MyRIP contains an N-terminal Slp homology domain (SHD) and functions as a linker protein that interacts with myosin Rab27A/B, VIIa/Va, and actin.
More...

AA Sequence

MGRKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSP      1 - 70
FTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKN     71 - 140
LYRKHRLESGACFDILGGSLFESNLENEGSISGSDSTFYRQSEGHSVMDTLAVALRVAEEAIEEAISKAE    141 - 210
AYGDSLDKQNEASYLRDHKEELTEELATTILQKIIRKQKSKSEQQVEEEPGWPHPQSCSTKVADEGTSAS    211 - 280
PGGYRAPAALWRSQSAFSITGEEALKTPPVEAPSRQPRDQGQHPRAESALPSWKSVDRLDETNLAPVLQS    281 - 350
PDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRN    351 - 420
PQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSREVGHQARLSWLQRKAPRNPAAEKMRL    421 - 490
HGELDVNFNPQLASRETSDSSEPEEAPHTTDRRARRWRRARLGSEEPSKEPSSPSAQLRDLDTHQVSDDL    491 - 560
SETDISNEARDPQTLTDTTEEKRRNRLYELAMKMSEKETSSGEDQESEPKTESENQKESLSSEDNSQSVQ    561 - 630
EELKKKFSAVSLCNISTEVLKVINATEELIAGSTGPWESPQVPPDRQKGMFPRGTDQVRLDEQLTSLEEN    631 - 700
VYLAAGTVYGLETQLTELEDAARCIHSGTDETHLADLEDQVATAAAQVHHAELQISDIESRISALTIAGL    701 - 770
NIAPCVRFTRRRDQKQRTQVQTIDTSRQQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKE    771 - 840
RKGTTKDLMEPALESAVMY                                                       841 - 859
//

Text Mined References (23)

PMID Year Title
26675235 2016 Interaction between MyRIP and the actin cytoskeleton regulates Weibel-Palade body trafficking and exocytosis.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22396429 2012 Myrip couples the capture of secretory granules by the actin-rich cell cortex and their attachment to the plasma membrane.
21740491 2011 Myosin Va acts in concert with Rab27a and MyRIP to regulate acute von-Willebrand factor release from endothelial cells.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20861866 2010 Genome-wide association identifies SKIV2L and MYRIP as protective factors for age-related macular degeneration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19270261 2009 Rab27a and MyRIP regulate the amount and multimeric state of VWF released from endothelial cells.
More...