Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.13
PubTator Score 11.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.398 1.4e-02
adult high grade glioma -2.600 1.5e-04
astrocytic glioma -2.500 6.9e-03
Astrocytoma, Pilocytic -1.100 2.6e-03
atypical teratoid / rhabdoid tumor -3.600 9.2e-07
ductal carcinoma in situ -1.300 6.6e-04
ependymoma -2.000 8.3e-03
gastric carcinoma -2.900 2.7e-02
glioblastoma -2.100 4.7e-06
intraductal papillary-mucinous adenoma (... -2.400 7.3e-04
intraductal papillary-mucinous neoplasm ... -3.100 1.1e-03
invasive ductal carcinoma -1.300 8.3e-03
lung adenocarcinoma -1.100 2.5e-10
lung cancer 2.000 2.7e-04
medulloblastoma -1.200 2.9e-02
medulloblastoma, large-cell -4.000 2.5e-07
non-small cell lung cancer -1.281 5.3e-11
oligodendroglioma -2.300 9.7e-03
osteosarcoma -1.638 1.7e-02
pancreatic cancer -1.700 9.5e-06
primitive neuroectodermal tumor -3.000 5.0e-05

Gene RIF (11)

AA Sequence

MGRKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSP      1 - 70
FTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKN     71 - 140
LYRKHRLESGACFDILGGSLFESNLENEGSISGSDSTFYRQSEGHSVMDTLAVALRVAEEAIEEAISKAE    141 - 210
AYGDSLDKQNEASYLRDHKEELTEELATTILQKIIRKQKSKSEQQVEEEPGWPHPQSCSTKVADEGTSAS    211 - 280
PGGYRAPAALWRSQSAFSITGEEALKTPPVEAPSRQPRDQGQHPRAESALPSWKSVDRLDETNLAPVLQS    281 - 350
PDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRN    351 - 420
PQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSREVGHQARLSWLQRKAPRNPAAEKMRL    421 - 490
HGELDVNFNPQLASRETSDSSEPEEAPHTTDRRARRWRRARLGSEEPSKEPSSPSAQLRDLDTHQVSDDL    491 - 560
SETDISNEARDPQTLTDTTEEKRRNRLYELAMKMSEKETSSGEDQESEPKTESENQKESLSSEDNSQSVQ    561 - 630
EELKKKFSAVSLCNISTEVLKVINATEELIAGSTGPWESPQVPPDRQKGMFPRGTDQVRLDEQLTSLEEN    631 - 700
VYLAAGTVYGLETQLTELEDAARCIHSGTDETHLADLEDQVATAAAQVHHAELQISDIESRISALTIAGL    701 - 770
NIAPCVRFTRRRDQKQRTQVQTIDTSRQQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKE    771 - 840
RKGTTKDLMEPALESAVMY                                                       841 - 859
//

Text Mined References (23)

PMID Year Title