Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $12,462.5
PubMed Score 3.55
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q8NFW1 B7ZMH0 C9K0G4 Q8IVT9
Symbols

Gene

 Grant Application (1)

Gene RIF (5)

PMID Text
24428702 Collage XXII interacts with collagen-binding integrins via the protein motifs GLQGER and GFKGER.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20222955 association between serum creatinine level and polymorphisms in the collagen type XXII alpha 1 (COL22A1) gene, on chromosome 8, and in the synaptotagmin-1 (SYT1) gene, on chromosome 12
20222955 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
15016833 collagen XXII is the first specific extracellular matrix protein present only at tissue junctions

AA Sequence

MAGLRGNAVAGLLWMLLLWSGGGGCQAQRAGCKSVHYDLVFLLDTSSSVGKEDFEKVRQWVANLVDTFEV      1 - 70
GPDRTRVGVVRYSDRPTTAFELGLFGSQEEVKAAARRLAYHGGNTNTGDALRYITARSFSPHAGGRPRDR     71 - 140
AYKQVAILLTDGRSQDLVLDAAAAAHRAGIRIFAVGVGEALKEELEEIASEPKSAHVFHVSDFNAIDKIR    141 - 210
GKLRRRLCENVLCPSVRVEGDRFKHTNGGTKEITGFDLMDLFSVKEILGKRENGAQSSYVRMGSFPVVQS    211 - 280
TEDVFPQGLPDEYAFVTTFRFRKTSRKEDWYIWQVIDQYSIPQVSIRLDGENKAVEYNAVGAMKDAVRVV    281 - 350
FRGSRVNDLFDRDWHKMALSIQAQNVSLHIDCALVQTLPIEERENIDIQGKTVIGKRLYDSVPIDFDLQR    351 - 420
IVIYCDSRHAELETCCDIPSGPCQVTVVTEPPPPPPPQRPPTPGSEQIGFLKTINCSCPAGEKGEMGVAG    421 - 490
PMGLPGPKGDIGAIGPVGAPGPKGEKGDVGIGPFGQGEKGEKGSLGLPGPPGRDGSKGMRGEPGELGEPG    491 - 560
LPGEVGMRGPQGPPGLPGPPGRVGAPGLQGERGEKGTRGEKGERGLDGFPGKPGDTGQQGRPGPSGVAGP    561 - 630
QGEKGDVGPAGPPGVPGSVVQQEGLKGEQGAPGPRGHQGAPGPPGARGPIGPEGRDGPPGLQGLRGKKGD    631 - 700
MGPPGIPGLLGLQGPPGPPGVPGPPGPGGSPGLPGEIGFPGKPGPPGPTGPPGKDGPNGPPGPPGTKGEP    701 - 770
GERGEDGLPGKPGLRGEIGEQGLAGRPGEKGEAGLPGAPGFPGVRGEKGDQGEKGELGLPGLKGDRGEKG    771 - 840
EAGPAGPPGLPGTTSLFTPHPRMPGEQGPKGEKGDPGLPGEPGLQGRPGELGPQGPTGPPGAKGQEGAHG    841 - 910
APGAAGNPGAPGHVGAPGPSGPPGSVGAPGLRGTPGKDGERGEKGAAGEEGSPGPVGPRGDPGAPGLPGP    911 - 980
PGKGKDGEPGLRGSPGLPGPLGTKAACGKVRGSENCALGGQCVKGDRGAPGIPGSPGSRGDPGIGVAGPP    981 - 1050
GPSGPPGDKGSPGSRGLPGFPGPQGPAGRDGAPGNPGERGPPGKPGLSSLLSPGDINLLAKDVCNDCPPG   1051 - 1120
PPGLPGLPGFKGDKGVPGKPGREGTEGKKGEAGPPGLPGPPGIAGPQGSQGERGADGEVGQKGDQGHPGV   1121 - 1190
PGFMGPPGNPGPPGADGIAGAAGPPGIQGSPGKEGPPGPQGPSGLPGIPGEEGKEGRDGKPGPPGEPGKA   1191 - 1260
GEPGLPGPEGARGPPGFKGHTGDSGAPGPRGESGAMGLPGQEGLPGKDGDTGPTGPQGPQGPRGPPGKNG   1261 - 1330
SPGSPGEPGPSGTPGQKGSKGENGSPGLPGFLGPRGPPGEPGEKGVPGKEGVPGKPGEPGFKGERGDPGI   1331 - 1400
KGDKGPPGGKGQPGDPGIPGHKGHTGLMGPQGLPGENGPVGPPGPPGQPGFPGLRGESPSMETLRRLIQE   1401 - 1470
ELGKQLETRLAYLLAQMPPAYMKSSQGRPGPPGPPGKDGLPGRAGPMGEPGRPGQGGLEGPSGPIGPKGE   1471 - 1540
RGAKGDPGAPGVGLRGEMGPPGIPGQPGEPGYAKDGLPGIPGPQGETGPAGHPGLPGPPGPPGQCDPSQC   1541 - 1610
AYFASLAARPGNVKGP                                                         1611 - 1626
//

Text Mined References (8)

PMID Year Title
24428702 2014 Collagen XXII binds to collagen-binding integrins via the novel motifs GLQGER and GFKGER.
23508266 2014 A genome-wide association study of bronchodilator response in asthmatics.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20222955 2010 A meta-analysis of genome-wide data from five European isolates reveals an association of COL22A1, SYT1, and GABRR2 with serum creatinine level.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15016833 2004 A novel marker of tissue junctions, collagen XXII.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.