Property Summary

NCBI Gene PubMed Count 65
Grant Count 55
R01 Count 26
Funding $4,888,908.09
PubMed Score 843.07
PubTator Score 166.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (59)

PMID Text
26791235 Identify of MLL-fusion/MYC dash, verticalmiR-26 dash, verticalTET1 signaling circuit in MLL-rearranged acute myeloid leukemia.
26711177 Here, the authors reveal the methylcytosine dioxygenases TET1 and TET2 as active regulators of CTCF-mediated alternative splicing through conversion of 5-methylcytosine to its oxidation derivatives.
26703470 these data show that hypoxia-inducible genes are regulated in a multilayered manner that includes epigenetic regulation via TETs and 5-hmC levels in addition to HIF stabilization.
26684294 our study demonstrated that DNA hypomethylation at the TET1 promoter was associated with childhood asthma in African Americans.
26546041 these data suggest a dual function of GADD45a in oxidative DNA demethylation, to promote directly or indirectly TET1 activity and to enhance subsequent 5-formylcytosine/5-carboxylcytosine removal.
26524525 crystal structures of TET2-5hmC-DNA and TET2-5fC-DNA complexes at 1.80 A and 1.97 A resolution, respectively
26376879 The downregulation of ALDOB could indicate a poor prognosis for HCC patients. In addition, ALDOB inhibits the invasive features of cell lines partly through TET1 expression.
26356709 rs3998860-G allele was significantly associated with the disease severity, suggesting an involvement of TET1 locus in the modulation of apoptosis and liver injury in Nonalcoholic Fatty Liver Disease.
26294212 Hypoxia deregulates TET1. TET1/3 levels were associated with tumor hypoxia, tumor malignancy, and poor prognosis in breast cancer patients. Coordinate functions of TET1 and TET3 were needed to activate TNFalpha-p38-MAPK signaling in hypoxia.
26207381 Our study indicates that early breast cancer patients with decreased expression of TET1 mRNA had worse overall survival.
More...

AA Sequence

MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKKKTEPKPPVPV      1 - 70
RSLLTRAGAARMNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPLVVAKSKKVPLSKGLEKQHDC     71 - 140
DYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSLLKGKSQETTQFWSQRVEDSKINIPTHSGPA    141 - 210
AEILPGPLEGTRCGEGLFSEETLNDTSGSPKMFAQDTVCAPFPQRATPKVTSQGNPSIQLEELGSRVESL    211 - 280
KLSDSYLDPIKSEHDCYPTSSLNKVIPDLNLRNCLALGGSTSPTSVIKFLLAGSKQATLGAKPDHQEAFE    281 - 350
ATANQQEVSDTTSFLGQAFGAIPHQWELPGADPVHGEALGETPDLPEIPGAIPVQGEVFGTILDQQETLG    351 - 420
MSGSVVPDLPVFLPVPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPP    421 - 490
VMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTT    491 - 560
VVTMPVPMVSTSSSSYTTLLPTLEKKKRKRCGVCEPCQQKTNCGECTYCKNRKNSHQICKKRKCEELKKK    561 - 630
PSVVVPLEVIKENKRPQREKKPKVLKADFDNKPVNGPKSESMDYSRCGHGEEQKLELNPHTVENVTKNED    631 - 700
SMTGIEVEKWTQNKKSQLTDHVKGDFSANVPEAEKSKNSEVDKKRTKSPKLFVQTVRNGIKHVHCLPAET    701 - 770
NVSFKKFNIEEFGKTLENNSYKFLKDTANHKNAMSSVATDMSCDHLKGRSNVLVFQQPGFNCSSIPHSSH    771 - 840
SIINHHASIHNEGDQPKTPENIPSKEPKDGSPVQPSLLSLMKDRRLTLEQVVAIEALTQLSEAPSENSSP    841 - 910
SKSEKDEESEQRTASLLNSCKAILYTVRKDLQDPNLQGEPPKLNHCPSLEKQSSCNTVVFNGQTTTLSNS    911 - 980
HINSATNQASTKSHEYSKVTNSLSLFIPKSNSSKIDTNKSIAQGIITLDNCSNDLHQLPPRNNEVEYCNQ    981 - 1050
LLDSSKKLDSDDLSCQDATHTQIEEDVATQLTQLASIIKINYIKPEDKKVESTPTSLVTCNVQQKYNQEK   1051 - 1120
GTIQQKPPSSVHNNHGSSLTKQKNPTQKKTKSTPSRDRRKKKPTVVSYQENDRQKWEKLSYMYGTICDIW   1121 - 1190
IASKFQNFGQFCPHDFPTVFGKISSSTKIWKPLAQTRSIMQPKTVFPPLTQIKLQRYPESAEEKVKVEPL   1191 - 1260
DSLSLFHLKTESNGKAFTDKAYNSQVQLTVNANQKAHPLTQPSSPPNQCANVMAGDDQIRFQQVVKEQLM   1261 - 1330
HQRLPTLPGISHETPLPESALTLRNVNVVCSGGITVVSTKSEEEVCSSSFGTSEFSTVDSAQKNFNDYAM   1331 - 1400
NFFTNPTKNLVSITKDSELPTCSCLDRVIQKDKGPYYTHLGAGPSVAAVREIMENRYGQKGNAIRIEIVV   1401 - 1470
YTGKEGKSSHGCPIAKWVLRRSSDEEKVLCLVRQRTGHHCPTAVMVVLIMVWDGIPLPMADRLYTELTEN   1471 - 1540
LKSYNGHPTDRRCTLNENRTCTCQGIDPETCGASFSFGCSWSMYFNGCKFGRSPSPRRFRIDPSSPLHEK   1541 - 1610
NLEDNLQSLATRLAPIYKQYAPVAYQNQVEYENVARECRLGSKEGRPFSGVTACLDFCAHPHRDIHNMNN   1611 - 1680
GSTVVCTLTREDNRSLGVIPQDEQLHVLPLYKLSDTDEFGSKEGMEAKIKSGAIEVLAPRRKKRTCFTQP   1681 - 1750
VPRSGKKRAAMMTEVLAHKIRAVEKKPIPRIKRKNNSTTTNNSKPSSLPTLGSNTETVQPEVKSETEPHF   1751 - 1820
ILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPAPLKNDATASCGFSERSSTPHCTMPSGRLSG   1821 - 1890
ANAAAADGPGISQLGEVAPLPTLSAPVMEPLINSEPSTGVTEPLTPHQPNHQPSFLTSPQDLASSPMEED   1891 - 1960
EQHSEADEPPSDEPLSDDPLSPAEEKLPHIDEYWSDSEHIFLDANIGGVAIAPAHGSVLIECARRELHAT   1961 - 2030
TPVEHPNRNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNE   2031 - 2100
LNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV                                     2101 - 2136
//

Text Mined References (70)

PMID Year Title
26791235 2016 Identification of MLL-fusion/MYC?miR-26?TET1 signaling circuit in MLL-rearranged leukemia.
26711177 2016 TET-catalyzed oxidation of intragenic 5-methylcytosine regulates CTCF-dependent alternative splicing.
26703470 2016 Fumarate and Succinate Regulate Expression of Hypoxia-inducible Genes via TET Enzymes.
26684294 2016 Ten-eleven translocation 1 (TET1) methylation is associated with childhood asthma and traffic-related air pollution.
26546041 GADD45a physically and functionally interacts with TET1.
26524525 2015 Structural insight into substrate preference for TET-mediated oxidation.
26376879 2015 Aldolase B inhibits metastasis through Ten-Eleven Translocation 1 and serves as a prognostic biomarker in hepatocellular carcinoma.
26356709 2015 Epigenetic Modifications in the Biology of Nonalcoholic Fatty Liver Disease: The Role of DNA Hydroxymethylation and TET Proteins.
26294212 2015 Hypoxia Drives Breast Tumor Malignancy through a TET-TNF?-p38-MAPK Signaling Axis.
26207381 2015 Reduced Expression of TET1, TET2, TET3 and TDG mRNAs Are Associated with Poor Prognosis of Patients with Early Breast Cancer.
More...