Property Summary

NCBI Gene PubMed Count 27
PubMed Score 39.03
PubTator Score 26.16

Knowledge Summary

Patent (524)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.4e-08
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.881 1.4e-08

Gene RIF (15)

AA Sequence

MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGKDKVGILQHPD      1 - 70
GTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKP     71 - 140
CIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSDSYETENQHYGRSLTKETIKDG    141 - 210
VSRFFHNGYCLRKDAVAASIQKIEKILQWFENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSK    211 - 280
GQLSDTEVLEYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMS    281 - 350
QEHLNGNVLSQLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN        351 - 416
//

Text Mined References (30)

PMID Year Title