Property Summary

NCBI Gene PubMed Count 23
Grant Count 32
R01 Count 12
Funding $4,021,193.03
PubMed Score 35.87
PubTator Score 26.16

Knowledge Summary

Patent (524)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.881 0.000

Gene RIF (11)

PMID Text
26195796 a severe loss of IPMK in the striatum of Huntington disease patients and in several cellular and animal models of the disease, is reported.
25865046 A hereditary form of small intestinal carcinoid associated with a germline mutation in IPMK.
24632208 Future research should focus on the hitherto unknown non-conventional import of IPMK and the potential impact of its dysregulation on IPMK signaling pathways regulating cellular growth and proliferation.
24074953 Our findings implicate IPMK in a transcript-selective mRNA export pathway controlled by phosphoinositide turnover that preserves genome integrity in humans.
23550211 Results suggest that inositol polyphosphate multikinase (IPMK) acts as a transcriptional coactivator for p53 and that it is an integral part of the p53 transcriptional complex facilitating cell death.
23322705 Knockdown of expression and/or inhibition of function of phospholipase Cgamma1, inositol polyphosphate multikinase, which generates inositol 1,3,4,5-tetrakisphosphate (InsP) and InsP, and inositol hexakisphosphate kinase 1/2
23050966 overview of possible roles of IPMK in regulation of metabolism: IPMK appears to mediate activation of mammalian target of rapamycin (mTOR) in response to essential amino acids. IPMK appears to mediate hypothalamic control of food intake. [REVIEW]
22718630 Phosphorylation of S284 by protein kinase CK2 significantly decreases nuclear targeting of IPMK in HEK-293 cells.
22715467 Data show that inositol polyphosphate multikinase (IPMK) interacts with the nuclear receptor steroidogenic factor 1 (SF-1) and phosphorylates its bound ligand Phosphatidylinositol 4,5-bisphosphate (PIP).
12223481 the major activity of human InsP(4) 5-kinase is phosphorylation at the D-5 position [InsP(4) 5-kinase]
More...

AA Sequence

MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGKDKVGILQHPD      1 - 70
GTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKP     71 - 140
CIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSDSYETENQHYGRSLTKETIKDG    141 - 210
VSRFFHNGYCLRKDAVAASIQKIEKILQWFENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSK    211 - 280
GQLSDTEVLEYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMS    281 - 350
QEHLNGNVLSQLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN        351 - 416
//

Text Mined References (26)

PMID Year Title
26195796 2015 Huntington's disease: Neural dysfunction linked to inositol polyphosphate multikinase.
25865046 2015 A Hereditary Form of Small Intestinal Carcinoid Associated With a Germline Mutation in Inositol Polyphosphate Multikinase.
24632208 2014 Efficacious inhibition of Importin ?/?-mediated nuclear import of human inositol phosphate multikinase.
24074953 2013 Human inositol polyphosphate multikinase regulates transcript-selective nuclear mRNA export to preserve genome integrity.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23550211 2013 Inositol polyphosphate multikinase is a coactivator of p53-mediated transcription and cell death.
23322705 2013 The regulation of runt-related transcription factor 2 by fibroblast growth factor-2 and connexin43 requires the inositol polyphosphate/protein kinase C? cascade.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
More...