Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.05
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -4.500 1.4e-12
chronic rhinosinusitis 3.968 1.5e-02
cystic fibrosis and chronic rhinosinusit... 4.874 6.2e-04
ductal carcinoma in situ 2.200 4.6e-02
interstitial cystitis 3.700 8.0e-04
lung adenocarcinoma 1.100 2.2e-05
non-small cell lung carcinoma 1.400 1.4e-15
psoriasis 2.000 1.1e-07
ulcerative colitis 3.900 2.8e-03

Gene RIF (8)

AA Sequence

MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPI      1 - 70
PIPESAPTTPLPSEK                                                            71 - 85
//

Text Mined References (13)

PMID Year Title