Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.04
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial cystitis 3.900 0.001
lung adenocarcinoma 1.800 0.000
non-small cell lung carcinoma 1.400 0.000
Breast cancer -4.500 0.000
ductal carcinoma in situ 2.200 0.046
ulcerative colitis 3.900 0.003
chronic rhinosinusitis 3.968 0.015
cystic fibrosis and chronic rhinosinusit... 4.874 0.001
psoriasis 2.000 0.000

Gene RIF (8)

PMID Text
26577469 LPS-induced upregulation of FDC-SP expression in human periodontal ligament cells may enhance osteoclastogenesis in periodontal disease.
25953661 FDC-SP may be involved in IgA production in the tonsils of Immunoglobulin A nephropathy patients.
24357406 Our findings demonstrate that transfection with FDC-SP has negligible adverse effect on proliferation of hPDLCs and imply the biological function of FDC-SP as a fibroblastic phenotype stabilizer
24138099 FDC-SP overexpression inhibits osteogenic differentiation of hPDLCs. study contributes to a better understanding of biological functions governing FDC-SP-induced hPDLC differentiation.
20811673 The role of C4orf7 in ovarian cancer cell morphology, motility and invasion was demonstrated.
17548624 These results provide the first evidence for immunomodulatory activities of FDC-SP and implicate this molecule as a regulator of B cell responses.
16259954 Since only normal tissue was examined, these findings suggest that FDC-SP plays an important but previously unsuspected role within oral connective tissue.
12193705 FDC-SP has a very restricted tissue distribution, expressed by activated FDCs from tonsils and TNF-alpha-activated FDC-like cell lines, but not by B cell lines, primary germinal center B cells, or anti-CD40 plus IL-4-activated B cells.

AA Sequence

MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPI      1 - 70
PIPESAPTTPLPSEK                                                            71 - 85
//

Text Mined References (13)

PMID Year Title
26577469 2016 Follicular dendritic cell-secreted protein may enhance osteoclastogenesis in periodontal disease.
25953661 2015 Decreased expression of follicular dendritic cell-secreted protein correlates with increased immunoglobulin A production in the tonsils of individuals with immunoglobulin A nephropathy.
24357406 2014 Transfection with follicular dendritic cell secreted protein to affect phenotype expression of human periodontal ligament cells.
24138099 2014 Osteogenic differentiation of human periodontal ligament cells after transfection with recombinant lentiviral vector containing follicular dendritic cell secreted protein.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
20811673 2010 C4orf7 contributes to ovarian cancer metastasis by promoting cancer cell migration and invasion.
17548624 2007 Follicular dendritic cell secreted protein (FDC-SP) regulates germinal center and antibody responses.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16259954 2005 Identification of genes preferentially expressed in periodontal ligament: specific expression of a novel secreted protein, FDC-SP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...