Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.67
PubTator Score 64.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.900 0.001
oligodendroglioma -1.600 0.000
osteosarcoma -3.244 0.000
medulloblastoma -4.200 0.000
cystic fibrosis 3.174 0.000
atypical teratoid / rhabdoid tumor -2.000 0.036
glioblastoma -2.800 0.001
medulloblastoma, large-cell -4.300 0.000
primitive neuroectodermal tumor -3.800 0.000
acute quadriplegic myopathy 1.354 0.000
adrenocortical carcinoma -1.784 0.002
tuberculosis 1.800 0.000
interstitial cystitis -1.600 0.000
pediatric high grade glioma -2.200 0.001
pilocytic astrocytoma -2.400 0.000
ductal carcinoma in situ 1.300 0.014
ulcerative colitis -1.300 0.000
ovarian cancer 1.200 0.027

Gene RIF (4)

PMID Text
24981631 Biosynthesis of a central intermediate in hydrogen sulfide metabolism by a novel human sulfurtransferase and its yeast ortholog.
21845542 The presence of kynurenine aminotransferase III in Corpora amylacea in the human retina and optic nerve indicates that this enzyme may be relevant in mechanisms of neurodegeneration leading to Corpora amylaceaformation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKL      1 - 70
EDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES                              71 - 115
//

Text Mined References (17)

PMID Year Title
24981631 2014 Biosynthesis of a central intermediate in hydrogen sulfide metabolism by a novel human sulfurtransferase and its yeast ortholog.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21845542 2011 Presence of L-kynurenine aminotransferase III in retinal ganglion cells and corpora amylacea in the human retina and optic nerve.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16337094 2006 Genomic structure, organization and promoter analysis of the human F11R/F11 receptor/junctional adhesion molecule-1/JAM-A.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12817473 2003 Identification and characterization of KAT, a novel gene preferentially expressed in several human cancer cell lines.
More...