Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.86
PubTator Score 13.82

Knowledge Summary

Patent (318)

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 3.000 0.000
active Crohn's disease -1.291 0.038
ulcerative colitis -3.200 0.000

Synonym

Accession Q8NFU0 Q5JR93
Symbols VMD2L2

Gene

Gene RIF (4)

PMID Text
24223998 BEST2 and BEST4 could be added to the lineage-specific genes of humans intestinal epithelial cells
19237432 Results provide evidence that the bestrophins are expressed in pancreatic duct cells and, more specifically, that hBest1 plays a role in the calcium activated chloride channels found in these cells.
16702355 Human Best4 chloride channels on excised membrane patches can be activated by free calcium (Ca2+) on the cytoplasmic side.
12032738 identified three novel VMD2-related human genes demonstrating a high degree of conservation in their respective RFP-TM domains

AA Sequence

MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITYRLLLTQEQRYVYAQVARYCN      1 - 70
RSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQRGRLLRRTLIRYANLASVLVL     71 - 140
RSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDFNKYWVPCVWFTNLAAQARRDGRIRDDIALCLL    141 - 210
LEELNKYRAKCSMLFHYDWISIPLVYTQVVTIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPA    211 - 280
LGDPDMYVPLTTLLQFFFYAGWLKVAEQIINPFGEDDDDFETNQLIDRNLQVSLLSVDEMYQNLPPAEKD    281 - 350
QYWDEDQPQPPYTVATAAESLRPSFLGSTFNLRMSDDPEQSLQVEASPGSGRPAPAAQTPLLGRFLGVGA    351 - 420
PSPAISLRNFGRVRGTPRPPHLLRFRAEEGGDPEAAARIEEESAESGDEALEP                     421 - 473
//

Text Mined References (10)

PMID Year Title
24223998 2013 Lineage-specific expression of bestrophin-2 and bestrophin-4 in human intestinal epithelial cells.
19237432 2009 Bestrophin expression and function in the human pancreatic duct cell line, CFPAC-1.
18400985 2008 Bestrophin Cl- channels are highly permeable to HCO3-.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16702355 2006 Ca2+-activated Cl- current from human bestrophin-4 in excised membrane patches.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12907679 2003 Structure-function analysis of the bestrophin family of anion channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032738 2002 Three novel human VMD2-like genes are members of the evolutionary highly conserved RFP-TM family.
9700209 1998 Mutations in a novel gene, VMD2, encoding a protein of unknown properties cause juvenile-onset vitelliform macular dystrophy (Best's disease).