Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.59
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
osteosarcoma -1.334 0.000
medulloblastoma, large-cell 1.400 0.000
lung cancer 2.000 0.000

Synonym

Accession Q8NFT6 D3DX56 Q8TEX0 Q96B19 Q9H912
Symbols DRF1
ASKL1
CHIFB
ZDBF1B

Gene

Gene RIF (3)

PMID Text
19111665 These results indicate that Ddk functions as an upstream regulator to monitor S-phase checkpoint signaling.
15668232 ASKL1 in a complex with Cdc7 may play a role in normal progression of both S and M phases
12065429 Results describe a novel human protein, Drf1, related to both human and yeast Dbf4. Drf1 is a nuclear cell cycle-regulated protein which binds to Cdc7 and activates the kinase.

AA Sequence

MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAI      1 - 70
QQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSV     71 - 140
PLSRGKELLQKAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLCVKKQQPKKPE    141 - 210
GTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESK    211 - 280
DGEPSPRSAAHTMPRRKKGYCECCQEAFEELHVHLQSAQHRSFALEAHLYAEVDRIIAQLSHSFADIPFQ    281 - 350
AGLPRWSGSPASDCDPLCPETLHPHQPSHPRAASPRIRKEDSCQASVTQGRAAGQQRWTESLDGVMGPPA    351 - 420
SHTCVSATTLLPALPKGSREQGCLCPCPASFTQSHLVTSLALLPGEWSPAEDMPLHPSQENSFAPADIPV    421 - 490
KGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPS    491 - 560
LSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLAVDSG                   561 - 615
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19111665 2008 The role of Dbf4/Drf1-dependent kinase Cdc7 in DNA-damage checkpoint control.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17062569 2007 Cdc7 is an active kinase in human cancer cells undergoing replication stress.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15668232 2005 A second human Dbf4/ASK-related protein, Drf1/ASKL1, is required for efficient progression of S and M phases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...