Property Summary

NCBI Gene PubMed Count 13
PubMed Score 48.47
PubTator Score 13.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -2.200 0.044
astrocytic glioma -2.100 0.001
ependymoma -2.800 0.002
oligodendroglioma -2.000 0.013
glioblastoma -2.000 0.000
group 3 medulloblastoma -2.800 0.000
cystic fibrosis 2.431 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -2.000 0.004
intraductal papillary-mucinous adenoma (... 1.200 0.044
interstitial cystitis -1.600 0.003
adult high grade glioma -1.800 0.000
subependymal giant cell astrocytoma -1.979 0.032
lung adenocarcinoma 1.400 0.000
Pick disease -1.100 0.015
invasive ductal carcinoma -1.400 0.045
ovarian cancer 1.400 0.003

Synonym

Accession Q8NFT2 A4D1F1 G5E9C6 Q6UXN6 Q6YPB1 Q8IUE7
Symbols STMP
IPCA1
PUMPCn
STAMP1
PCANAP1

Gene

Gene RIF (8)

PMID Text
25248617 Over-expression of STEAP2 is associated with prostate cancer progression.
20587517 Data suggest that STAMP1 is required for prostate cancer growth.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19196137 STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice.
16609065 The murine ortholog, Steap2, is a ferrireductase, cupric reductase, and stimulates cellular uptake of both iron and copper in vitro.
15897894 Expression of STAMP2, a gene highly similar to STAMP1 (STEAP2), in prostate cancer cells significantly increases cell growth and colony formation suggesting that STAMP2 may have a role in cell proliferation.
12429817 STEAP2 is involved in the development of prostate cancer. As a cell-surface antigen, it is a potential diagnostic or therapeutic target in prostate cancer.
12095985 cloning and characterization of STAMP1, which is expressed in both normal prostate and prostate neoplasms

AA Sequence

MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFF      1 - 70
PHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDS     71 - 140
LIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFT    141 - 210
LWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAY    211 - 280
QLYYGTKYRRFPPWLETWLQCRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWN    281 - 350
EEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFE    351 - 420
EEYYRFYTPPNFVLALVLPSIVILGKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM    421 - 490
//

Text Mined References (16)

PMID Year Title
25248617 2014 A role for STEAP2 in prostate cancer progression.
20587517 2010 STAMP1 is both a proliferative and an antiapoptotic factor in prostate cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19196137 2009 Six-transmembrane epithelial antigen of the prostate (STEAP1 and STEAP2)-differentially expressed by murine and human mesenchymal stem cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16609065 2006 The Steap proteins are metalloreductases.
15897894 2005 Molecular cloning and characterization of STAMP2, an androgen-regulated six transmembrane protein that is overexpressed in prostate cancer.
15623366 2004 ACRATA: a novel electron transfer domain associated to apoptosis and cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...