Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.24
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.2e-62
juvenile dermatomyositis 1187 1.3e-10
Disease Target Count Z-score Confidence
Cutaneous candidiasis 3 4.267 2.1
Orbital disease 4 3.216 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
juvenile dermatomyositis -1.067 1.3e-10
psoriasis -1.100 8.2e-62

Protein-protein Interaction (10)

Gene RIF (3)

AA Sequence

MGSSRLAALLLPLLLIVIDLSDSAGIGFRHLPHWNTRCPLASHTDDSFTGSSAYIPCRTWWALFSTKPWC      1 - 70
VRVWHCSRCLCQHLLSGGSGLQRGLFHLLVQKSKKSSTFKFYRRHKMPAPAQRKLLPRRHLSEKSHHISI     71 - 140
PSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWAL    141 - 210
ECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTD    211 - 280
YSQHTQMVMALTLRCPLKLEAALCQRHDWHTLCKDLPNATARESDGWYVLEKVDLHPQLCFKFSFGNSSH    281 - 350
VECPHQTGSLTSWNVSMDTQAQQLILHFSSRMHATFSAAWSLPGLGQDTLVPPVYTVSQARGSSPVSLDL    351 - 420
IIPFLRPGCCVLVWRSDVQFAWKHLLCPDVSYRHLGLLILALLALLTLLGVVLALTCRRPQSGPGPARPV    421 - 490
LLLHAADSEAQRRLVGALAELLRAALGGGRDVIVDLWEGRHVARVGPLPWLWAARTRVAREQGTVLLLWS    491 - 560
GADLRPVSGPDPRAAPLLALLHAAPRPLLLLAYFSRLCAKGDIPPPLRALPRYRLLRDLPRLLRALDARP    561 - 630
FAEATSWGRLGARQRRQSRLELCSRLEREAARLADLG                                     631 - 667
//

Text Mined References (13)

PMID Year Title