Property Summary

NCBI Gene PubMed Count 4
PubMed Score 34.61
PubTator Score 13.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 3.9e-04
atypical teratoid / rhabdoid tumor -1.400 1.5e-07
fibroadenoma 1.100 6.7e-04
glioblastoma -1.400 2.8e-05
group 4 medulloblastoma -1.400 6.3e-05
medulloblastoma, large-cell -1.900 5.4e-05

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY      1 - 70
HSTISN                                                                     71 - 76
//

Text Mined References (5)

PMID Year Title