Property Summary

NCBI Gene PubMed Count 4
PubMed Score 33.58
PubTator Score 13.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma 1524 6.96500946750725E-8
atypical teratoid / rhabdoid tumor 4369 1.5171726229925E-7
glioblastoma 5572 2.79274667147893E-5
medulloblastoma, large-cell 6234 5.42595806136075E-5
adult high grade glioma 2148 3.85210203079055E-4
fibroadenoma 557 6.6727801388727E-4
Disease Target Count Z-score Confidence
Hypochondriasis 7 4.056 2.0
Neurotic disorder 9 3.368 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.900 0.000
fibroadenoma 1.100 0.001
adult high grade glioma -1.100 0.000

Synonym

Accession Q8NFR3 B2R5D3 D3DNM8 Q0P5S6
Symbols ADMP
SSSPTB
C3orf57

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
15777716 ADMP expression was seen predominantly in the prostate epithelium with weaker expression in the fibroblasts and endothelial cells.

AA Sequence

MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY      1 - 70
HSTISN                                                                     71 - 76
//

Text Mined References (5)

PMID Year Title
19416851 2009 Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities.
15777716 2005 Molecular cloning and characterization of a novel androgen repressible gene expressed in the prostate epithelium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.